SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008692 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008692
Domain Number 1 Region: 65-368,535-570
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-48
Family FAD-linked reductases, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008692   Gene: ENSMPUG00000008763   Transcript: ENSMPUT00000008835
Sequence length 610
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:24937120:24948510:-1 gene:ENSMPUG00000008763 transcript:ENSMPUT00000008835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSLLLLLALLLLAVFRKGHLRLSAGGSPNPFSEDVRRTPAPLVTDKKARKKVLKRAFS
ASQVPENLDAVVIGSGFGGLAAAAILAKAGKRVLVLEQHSKAGGCCHTFGQKGVEFDTGI
HYVGSMQEDGICRLALDQITEGQLDWAALSSPFDILVLEGPNGRKEFPMYSGEKAYIQGL
KEKFPQEEAAIDKYVKLVKVVSRGAIHAVLLKMLPLRLAQLISKCGPLTRFFPFLRASTQ
SLADVLWQLPASPELRAVLSYIFPTYGVTPNHSAFSMHALVVDHYIEGAFYPRGGTSEIA
FHTIPVIQRAGGAVLTHATVQSVLLDSAGKACGVTVKNGQELVNICCPIVISDAGLFNTY
KYLLPENARCLPGVKQQLEMVRPGLGAFSVFISLRGTKEDLGLQSTNYFVCFDTDLDKAM
EHYLSAPREKAAAHVPIFFISSSSAKDPTWEDRFPERSTMIVLMPTCYEWFEEWREEAKG
RRSSDYETLKNSFVEASLSVVMRLFPQLEGKVDSVAGGSPLTYQFYLAAPRGACYGADHD
LDRLHPHVIASMRAQTPIPNLYLTGQDIFTCGLMGALQGALLCCSAILKRNLYLDLKKLH
SRIHAQKKQH
Download sequence
Identical sequences M3YBI5
ENSMPUP00000008692 ENSMPUP00000008692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]