SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000797 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000797
Domain Number 1 Region: 300-491
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.28e-42
Family Hemopexin-like domain 0.00037
Further Details:      
 
Domain Number 2 Region: 121-276
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.15e-34
Family Matrix metalloproteases, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 41-107
Classification Level Classification E-value
Superfamily PGBD-like 0.000022
Family MMP N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.204 18.78
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95

Protein sequence

External link(s) Protein: ENSNLEP00000000797   Gene: ENSNLEG00000000684   Transcript: ENSNLET00000000847
Sequence length 518
Comment pep:known_by_projection supercontig:Nleu1.0:GL397421.1:1807814:1816961:-1 gene:ENSNLEG00000000684 transcript:ENSNLET00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRY
GWSGVRAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAQPRGSPDGGAAQAF
SKRTLSWRLLGEALSSQLSAAEQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFG
RGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDMGISLLKVAVHEIGHVLGL
PHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVM
VRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFF
QGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLV
FAFDVNRNRVLNSYPKKITEVFPAIIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVN
DKDKQQNSWLPANGLFPKKFISEKWFDVCDVHISTLNM
Download sequence
Identical sequences G1QIQ4
ENSNLEP00000000797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]