SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000000797 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000797
Domain Number 1 Region: 300-491
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.28e-42
Family Hemopexin-like domain 0.00037
Further Details:      
 
Domain Number 2 Region: 121-276
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.15e-34
Family Matrix metalloproteases, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 41-107
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-05
Family MMP N-terminal domain 0.035
Further Details:      
 

Protein sequence

External link(s) Protein: ENSNLEP00000000797   Gene: ENSNLEG00000000684   Transcript: ENSNLET00000000847
Sequence length 518
Comment pep:known_by_projection supercontig:Nleu1.0:GL397421.1:1807814:1816961:-1 gene:ENSNLEG00000000684 transcript:ENSNLET00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRY
GWSGVRAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAQPRGSPDGGAAQAF
SKRTLSWRLLGEALSSQLSAAEQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFG
RGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDMGISLLKVAVHEIGHVLGL
PHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVM
VRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFF
QGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLV
FAFDVNRNRVLNSYPKKITEVFPAIIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVN
DKDKQQNSWLPANGLFPKKFISEKWFDVCDVHISTLNM
Download sequence
Identical sequences G1QIQ4
ENSNLEP00000000797

Jump to [ Top of page · Domain architecture · Domain assignment details ]