SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000000797 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000797
Domain Number 1 Region: 300-491
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.28e-42
Family Hemopexin-like domain 0.00037
Further Details:      
 
Domain Number 2 Region: 121-276
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.15e-34
Family Matrix metalloproteases, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 41-107
Classification Level Classification E-value
Superfamily PGBD-like 0.000022
Family MMP N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSNLEP00000000797   Gene: ENSNLEG00000000684   Transcript: ENSNLET00000000847
Sequence length 518
Comment pep:known_by_projection supercontig:Nleu1.0:GL397421.1:1807814:1816961:-1 gene:ENSNLEG00000000684 transcript:ENSNLET00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRY
GWSGVRAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAQPRGSPDGGAAQAF
SKRTLSWRLLGEALSSQLSAAEQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFG
RGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDMGISLLKVAVHEIGHVLGL
PHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVM
VRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFF
QGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLV
FAFDVNRNRVLNSYPKKITEVFPAIIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVN
DKDKQQNSWLPANGLFPKKFISEKWFDVCDVHISTLNM
Download sequence
Identical sequences G1QIQ4
ENSNLEP00000000797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]