SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000004082 from Nomascus leucogenys 73_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004082
Domain Number 1 Region: 362-559
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-69
Family Hemopexin-like domain 8.18e-06
Further Details:      
 
Domain Number 2 Region: 136-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-53
Family Matrix metalloproteases, catalytic domain 6.22e-07
Further Details:      
 
Domain Number 3 Region: 53-116
Classification Level Classification E-value
Superfamily PGBD-like 1.1e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Protein sequence

External link(s) Protein: ENSNLEP00000004082   Gene: ENSNLEG00000003342   Transcript: ENSNLET00000004282
Sequence length 669
Comment pep:novel supercontig:Nleu1.0:GL397289.1:10399981:10419044:1 gene:ENSNLEG00000003342 transcript:ENSNLET00000004282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMDAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDMGDGDGD
FGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLY
CKRSLQEWV
Download sequence
Identical sequences G1QT14
ENSNLEP00000004082 ENSNLEP00000004082

Jump to [ Top of page · Domain architecture · Domain assignment details ]