SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000004082 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004082
Domain Number 1 Region: 362-559
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-69
Family Hemopexin-like domain 0.00000818
Further Details:      
 
Domain Number 2 Region: 136-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-53
Family Matrix metalloproteases, catalytic domain 0.000000622
Further Details:      
 
Domain Number 3 Region: 53-116
Classification Level Classification E-value
Superfamily PGBD-like 1.1e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSNLEP00000004082   Gene: ENSNLEG00000003342   Transcript: ENSNLET00000004282
Sequence length 669
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:10399981:10419044:1 gene:ENSNLEG00000003342 transcript:ENSNLET00000004282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMDAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDMGDGDGD
FGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLY
CKRSLQEWV
Download sequence
Identical sequences G1QT14
ENSNLEP00000004082 ENSNLEP00000004082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]