SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000006439 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000006439
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily PGBD-like 0.0636
Family Peptidoglycan binding domain, PGBD 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006439   Gene: ENSNLEG00000005330   Transcript: ENSNLET00000006767
Sequence length 262
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:1680435:1686237:-1 gene:ENSNLEG00000005330 transcript:ENSNLET00000006767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARGLQELRGRA
DELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCA
RCASQGSQLSTESLQQLLDRALTVLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHV
RAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGST
GTMGGGSSAGTPQKHEGSAPEQ
Download sequence
Identical sequences G1QZR8
ENSNLEP00000006439 ENSNLEP00000006439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]