SUPERFAMILY 1.75 HMM library and genome assignments server

  Home > Genomes > Nomascus leucogenys 71_1.0 > ENSNLEP00000006439

Domain assignment for ENSNLEP00000006439 from Nomascus leucogenys 71_1.0

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000006439
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily PGBD-like 0.0636
Family Peptidoglycan binding domain, PGBD 0.035
Further Details:      
 

Protein sequence

External link(s) Protein: ENSNLEP00000006439   Gene: ENSNLEG00000005330   Transcript: ENSNLET00000006767
Sequence length 262
Comment pep:novel supercontig:Nleu1.0:GL397326.1:1680435:1686237:-1 gene:ENSNLEG00000005330 transcript:ENSNLET00000006767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
RREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARGLQELRGRA
DELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCA
RCASQGSQLSTESLQQLLDRALTVLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHV
RAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGST
GTMGGGSSAGTPQKHEGSAPEQ
Download sequence
Identical sequences G1QZR8
ENSNLEP00000006439 ENSNLEP00000006439

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.