SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000008757 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008757
Domain Number 1 Region: 284-477
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.22e-69
Family Hemopexin-like domain 5.76e-07
Further Details:      
 
Domain Number 2 Region: 101-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.28e-59
Family Matrix metalloproteases, catalytic domain 3.06e-08
Further Details:      
 
Domain Number 3 Region: 33-97
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-20
Family MMP N-terminal domain 3e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSNLEP00000008757   Gene: ENSNLEG00000007178   Transcript: ENSNLET00000009175
Sequence length 477
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:35948457:35956266:-1 gene:ENSNLEG00000007178 transcript:ENSNLET00000009175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLPILLFLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGQFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPAKCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELYLISSFWPSLPSGVDAAYEVTSKDLVFVFKGSQF
WAIRGNEVQAGYPRGIHTLGFPPTVRKIDAAISDKEKKKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Download sequence
Identical sequences G1R6D5
ENSNLEP00000008757 ENSNLEP00000008757

Jump to [ Top of page · Domain architecture · Domain assignment details ]