SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000008760 from Nomascus leucogenys 73_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008760
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-67
Family Hemopexin-like domain 1.48e-06
Further Details:      
 
Domain Number 2 Region: 103-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.88e-58
Family Matrix metalloproteases, catalytic domain 9.76e-08
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 7.06e-21
Family MMP N-terminal domain 0.00099
Further Details:      
 

Protein sequence

External link(s) Protein: ENSNLEP00000008760   Gene: ENSNLEG00000007183   Transcript: ENSNLET00000009178
Sequence length 470
Comment pep:novel supercontig:Nleu1.0:GL397262.1:35982175:35994473:-1 gene:ENSNLEG00000007183 transcript:ENSNLET00000009178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILLLQATASGALPLNSSTSLEKNDVLFGERYLERFYGLEMNKLSMTKMKYSGNLM
KEKIQEMQQFLGLKVTGQLDTATLEMMHAPRCGVPDVHHLREMSGRPVWRKHYITYRINN
YTPDMNREDVDNTIRKAFQVWSNVTPLKFSKIKTGVADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDDDEFWTTHSEGTNLFLTAVHEIGHSLGLGHSSDPKAIMFPTY
KYVDINTFRLSADDIRGIQSLYGYPKENQPLPNPDNSEPALCDPNLSFDAVTRVGDKIFF
FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRP
EPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVGNQYWRYNERTQMMDPGYPKLITK
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRVTKTLKSNSWFDC
Download sequence
Identical sequences G1R6D8
ENSNLEP00000008760 ENSNLEP00000008760

Jump to [ Top of page · Domain architecture · Domain assignment details ]