SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008760 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008760
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-67
Family Hemopexin-like domain 0.00000148
Further Details:      
 
Domain Number 2 Region: 103-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.88e-58
Family Matrix metalloproteases, catalytic domain 0.0000000976
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 7.06e-21
Family MMP N-terminal domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008760   Gene: ENSNLEG00000007183   Transcript: ENSNLET00000009178
Sequence length 470
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:35982175:35994473:-1 gene:ENSNLEG00000007183 transcript:ENSNLET00000009178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLILLLQATASGALPLNSSTSLEKNDVLFGERYLERFYGLEMNKLSMTKMKYSGNLM
KEKIQEMQQFLGLKVTGQLDTATLEMMHAPRCGVPDVHHLREMSGRPVWRKHYITYRINN
YTPDMNREDVDNTIRKAFQVWSNVTPLKFSKIKTGVADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDDDEFWTTHSEGTNLFLTAVHEIGHSLGLGHSSDPKAIMFPTY
KYVDINTFRLSADDIRGIQSLYGYPKENQPLPNPDNSEPALCDPNLSFDAVTRVGDKIFF
FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRP
EPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVGNQYWRYNERTQMMDPGYPKLITK
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRVTKTLKSNSWFDC
Download sequence
Identical sequences G1R6D8
XP_003253102.1.23891 ENSNLEP00000008760 ENSNLEP00000008760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]