SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSNLEP00000012434 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012434
Domain Number 1 Region: 292-488
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.84e-69
Family Hemopexin-like domain 7.46e-06
Further Details:      
 
Domain Number 2 Region: 80-246
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.2e-57
Family Matrix metalloproteases, catalytic domain 1.14e-07
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily PGBD-like 4.87e-19
Family MMP N-terminal domain 0.0041
Further Details:      
 

Protein sequence

External link(s) Protein: ENSNLEP00000012434   Gene: ENSNLEG00000010203   Transcript: ENSNLET00000013041
Sequence length 564
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:6817320:6847828:1 gene:ENSNLEG00000010203 transcript:ENSNLET00000013041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGV
PDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPL
TFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD
EPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQG
IQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICD
GNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFV
FFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSE
ERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRN
ILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYT
IFQFKNKTGPQPVTYYKRPVQEWV
Download sequence
Identical sequences G1RGT4
ENSNLEP00000012434 ENSNLEP00000012434

Jump to [ Top of page · Domain architecture · Domain assignment details ]