SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012434 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012434
Domain Number 1 Region: 292-488
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.84e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 80-246
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.2e-57
Family Matrix metalloproteases, catalytic domain 0.000000114
Further Details:      
 
Domain Number 3 Region: 1-63
Classification Level Classification E-value
Superfamily PGBD-like 4.87e-19
Family MMP N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSNLEP00000012434   Gene: ENSNLEG00000010203   Transcript: ENSNLET00000013041
Sequence length 564
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:6817320:6847828:1 gene:ENSNLEG00000010203 transcript:ENSNLET00000013041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGV
PDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPL
TFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSD
EPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQG
IQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICD
GNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFV
FFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSE
ERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRN
ILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYT
IFQFKNKTGPQPVTYYKRPVQEWV
Download sequence
Identical sequences G1RGT4
ENSNLEP00000012434 ENSNLEP00000012434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]