SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345004173|ref|YP_004807026.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345004173|ref|YP_004807026.1|
Domain Number 1 Region: 352-587
Classification Level Classification E-value
Superfamily PHP domain-like 1.09e-43
Family PHP domain 0.0012
Further Details:      
 
Domain Number 2 Region: 158-328
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.4e-38
Family DNA polymerase beta-like 0.0033
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000000000589
Family DNA polymerase beta, N-terminal domain-like 0.0035
Further Details:      
 
Domain Number 4 Region: 64-149
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.000000837
Family Achaeal helicase C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345004173|ref|YP_004807026.1|
Sequence length 590
Comment PHP domain-containing protein [halophilic archaeon DL31]
Sequence
MPTNDELATLLEEMADLLDAQDVAYKPSAYRRAAENVREHADPVEELAQDGGEDAVGEIN
RVGDAIASKLVEYVETGEITELEELREELPVDMASLTSVEGVGPKTVGSLYEALGITDLE
ELEAAAEAGEIQAVTGFGPKTEQNILDGIEFAKQARTRTLLGEARPLGESLREYLTESEA
VETAELAGSNRRWCETIGDVDVLAASDDGEAVVDAFLDWEDGTDTIEAGSTKASVRTGSG
IRVDLRVVDPAEFGAALQYFTGSRDHNIRLRNRAIDRDLKMNEYGLFDISAVDDPDSGQR
VGERVAGETEAGMYEKLDLPLIPPELREDAGEVAAAADGDLPDLLEEEEIQGDLHTHSEW
SDGDAPIEEMALGAVEAGHDYLALTDHAAGPGVFGNTGLSPDELREQQEAVEAVRETLAD
DGQDLTLLHGVETNITADGELSTPDDLLEELDVVVASPHAALGQDRETATDRLVAAIKHP
ETDILGHPTGRLLNQRPGLSPDFERLAEAAAESGTALELNANPNRLDLSSDAVRIAVEAA
ATVAINTDAHRPGAFSERRFGVHTARRGWAETGDVLTAQPIEAVRSFLDG
Download sequence
Identical sequences G2MJA4
WP_014050434.1.75361 gi|345004173|ref|YP_004807026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]