SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345005296|ref|YP_004808149.1| from halophilic archaeon DL31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345005296|ref|YP_004808149.1|
Domain Number 1 Region: 6-228
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.76e-74
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000269
Further Details:      
 
Domain Number 2 Region: 230-380
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 4.67e-61
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|345005296|ref|YP_004808149.1|
Sequence length 381
Comment butyryl-CoA dehydrogenase [halophilic archaeon DL31]
Sequence
MELRTDSALTAEQRAIRDVVHEFALEELRPAAQEADAEESFPEDAWDRLAELDITGLTVP
EEYGGFDADSGTYAVVNEAVAYGHLAVATALSVHCLATSCIAEFGSDEVKDEWLPEMVDG
RPVGAFCLSEPGAGSNPAQMTTTAEKTEDGYRLSGEKQWITNGQRAGVYIVFAKTDPEDR
GSITQFLVPADYDGVEVGKKEHKLGLRASDTTGMTFDGVEIPEKYRLTPEGEGLSAAFRI
LTGGRLGIASQALGVAQAALDEAVDYAGNREQFGKPIGEIQTIRHKIADMATQVQASRLL
CREAARMADNGEDPRTIASMAKYFASEAAMDVTNEAVQIHGGYGYMSEFDVERFYRDAKI
TTIYEGTSEIQKTIIARDLLD
Download sequence
Identical sequences G2MLU9
WP_014051553.1.75361 gi|345005296|ref|YP_004808149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]