SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSAMEP00000007670 from Ailuropoda melanoleuca 73_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007670
Domain Number 1 Region: 312-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-69
Family Hemopexin-like domain 1.2e-05
Further Details:      
 
Domain Number 2 Region: 114-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.5e-55
Family Matrix metalloproteases, catalytic domain 2.47e-08
Further Details:      
 
Domain Number 3 Region: 28-97
Classification Level Classification E-value
Superfamily PGBD-like 5.97e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Protein sequence

External link(s) Protein: ENSAMEP00000007670   Gene: ENSAMEG00000007272   Transcript: ENSAMET00000007991
Sequence length 582
Comment pep:known_by_projection scaffold:ailMel1:GL193372.1:358539:366896:1 gene:ENSAMEG00000007272 transcript:ENSAMET00000007991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPTGGPLLPLLTLATALASLSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSF
SAAIAAMQKFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQH
NEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFF
AEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDVNGNDIFLVAVHEL
GHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSQSGSPTKMPPQPRTTS
RPSVPDKPKNPTYGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFW
RGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFW
MPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGN
KYWKFNNQKLKVEPGYPKSALRDWMGCPASGGRPDEGTEEETEVIIIEVDEEGSGAVSAA
AVALPVLLLLLVLAAGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences G1LL48
ENSAMEP00000007670 ENSAMEP00000007670

Jump to [ Top of page · Domain architecture · Domain assignment details ]