SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017349 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017349
Domain Number 1 Region: 453-651
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.63e-68
Family Hemopexin-like domain 0.00000000216
Further Details:      
 
Domain Number 2 Region: 83-212,382-437
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.41e-37
Family Matrix metalloproteases, catalytic domain 0.000000353
Further Details:      
 
Domain Number 3 Region: 328-384
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 0.0000694
Further Details:      
 
Domain Number 4 Region: 38-101
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-20
Family MMP N-terminal domain 0.0000671
Further Details:      
 
Domain Number 5 Region: 215-270
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 271-305
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000685
Family Fibronectin type II module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endoplasmic reticulum subcompartment 1.59 31.26
nuclear outer membrane-endoplasmic reticulum membrane network 1.527 31.26
Golgi lumen 2.224 18.39
extracellular space 1.3 13.42
vesicle lumen 2.247 10.88
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
insulin-like growth factor binding 1.805 33.2
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
carbohydrate binding 1.847 14.1
protein tyrosine kinase activity 1.549 12.66
integrin binding 1.56 12.29

Protein sequence

External link(s) Protein: ENSAMEP00000017349   Gene: ENSAMEG00000016417   Transcript: ENSAMET00000018059
Sequence length 651
Comment pep:known_by_projection scaffold:ailMel1:GL192338.1:1983605:2006551:1 gene:ENSAMEG00000016417 transcript:ENSAMET00000018059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGALAGPLRALCVLGCLLGRAAAAPSPXXXXXXXXXPRGVHFFQQYLNTFYGCPKESCN
LFVLKDALKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITY
RIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDG
KDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYTS
CTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYESCT
TEGXXXXXXXXXXXPYGPLARVPLSTAMSTVGGNSEGAPCVFPFTFLGNKHESCTSAGRS
DGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTK
NFRLSHDDIKGIQELYGASPDTGTGTGPTPTLGPITPEICKQDVVFDGISQIRGEIFFFK
DRFIWRTVTPRNKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLE
RGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIGDA
WNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences G1MDC1
ENSAMEP00000017349 ENSAMEP00000017349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]