SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSAMEP00000017349 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017349
Domain Number 1 Region: 453-651
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.63e-68
Family Hemopexin-like domain 2.16e-09
Further Details:      
 
Domain Number 2 Region: 83-212,382-437
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.41e-37
Family Matrix metalloproteases, catalytic domain 3.53e-07
Further Details:      
 
Domain Number 3 Region: 328-384
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 6.94e-05
Further Details:      
 
Domain Number 4 Region: 38-101
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-20
Family MMP N-terminal domain 6.71e-05
Further Details:      
 
Domain Number 5 Region: 215-270
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-20
Family Fibronectin type II module 5.28e-05
Further Details:      
 
Domain Number 6 Region: 271-305
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-08
Family Fibronectin type II module 0.00059
Further Details:      
 

Protein sequence

External link(s) Protein: ENSAMEP00000017349   Gene: ENSAMEG00000016417   Transcript: ENSAMET00000018059
Sequence length 651
Comment pep:known_by_projection scaffold:ailMel1:GL192338.1:1983605:2006551:1 gene:ENSAMEG00000016417 transcript:ENSAMET00000018059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGALAGPLRALCVLGCLLGRAAAAPSPXXXXXXXXXPRGVHFFQQYLNTFYGCPKESCN
LFVLKDALKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITY
RIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDG
KDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYTS
CTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYESCT
TEGXXXXXXXXXXXPYGPLARVPLSTAMSTVGGNSEGAPCVFPFTFLGNKHESCTSAGRS
DGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTK
NFRLSHDDIKGIQELYGASPDTGTGTGPTPTLGPITPEICKQDVVFDGISQIRGEIFFFK
DRFIWRTVTPRNKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLE
RGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIGDA
WNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences G1MDC1
ENSAMEP00000017349 ENSAMEP00000017349

Jump to [ Top of page · Domain architecture · Domain assignment details ]