SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSAMEP00000017349 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017349
Domain Number 1 Region: 453-651
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.63e-68
Family Hemopexin-like domain 2.16e-09
Further Details:      
 
Domain Number 2 Region: 83-212,382-437
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.41e-37
Family Matrix metalloproteases, catalytic domain 3.53e-07
Further Details:      
 
Domain Number 3 Region: 328-384
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 6.94e-05
Further Details:      
 
Domain Number 4 Region: 38-101
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-20
Family MMP N-terminal domain 6.71e-05
Further Details:      
 
Domain Number 5 Region: 215-270
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-20
Family Fibronectin type II module 5.28e-05
Further Details:      
 
Domain Number 6 Region: 271-305
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-08
Family Fibronectin type II module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear envelope lumen 2.038 43.9
brush border 1.48 22.54
cytoplasmic vesicle part 1.737 14.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
axon 1.502 9.86
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
cell body 1.492 7.9

Protein sequence

External link(s) Protein: ENSAMEP00000017349   Gene: ENSAMEG00000016417   Transcript: ENSAMET00000018059
Sequence length 651
Comment pep:known_by_projection scaffold:ailMel1:GL192338.1:1983605:2006551:1 gene:ENSAMEG00000016417 transcript:ENSAMET00000018059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGALAGPLRALCVLGCLLGRAAAAPSPXXXXXXXXXPRGVHFFQQYLNTFYGCPKESCN
LFVLKDALKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITY
RIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDG
KDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYTS
CTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYESCT
TEGXXXXXXXXXXXPYGPLARVPLSTAMSTVGGNSEGAPCVFPFTFLGNKHESCTSAGRS
DGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTK
NFRLSHDDIKGIQELYGASPDTGTGTGPTPTLGPITPEICKQDVVFDGISQIRGEIFFFK
DRFIWRTVTPRNKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLE
RGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIGDA
WNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences G1MDC1
ENSAMEP00000017349 ENSAMEP00000017349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]