SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017353 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017353
Domain Number 1 Region: 21-88
Classification Level Classification E-value
Superfamily PGBD-like 3.77e-21
Family MMP N-terminal domain 0.0000671
Further Details:      
 
Domain Number 2 Region: 92-154
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.36e-16
Family Matrix metalloproteases, catalytic domain 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
presynapse 1.761 5.66

Protein sequence

External link(s) Protein: ENSAMEP00000017353   Gene: ENSAMEG00000016417   Transcript: ENSAMET00000018063
Sequence length 155
Comment pep:known_by_projection scaffold:ailMel1:GL192338.1:1985608:1987594:1 gene:ENSAMEG00000016417 transcript:ENSAMET00000018063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WILETSAVFTSFSPILAQGLTHSGSQKIFVEQQYLNTFYGCPKESCNLFVLKDALKKMQK
FFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPET
VDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFG
Download sequence
Identical sequences G1MDC5
ENSAMEP00000017353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]