SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSAMEP00000017353 from Ailuropoda melanoleuca 71_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017353
Domain Number 1 Region: 21-88
Classification Level Classification E-value
Superfamily PGBD-like 3.77e-21
Family MMP N-terminal domain 6.71e-05
Further Details:      
 
Domain Number 2 Region: 92-154
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.36e-16
Family Matrix metalloproteases, catalytic domain 2.83e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSAMEP00000017353   Gene: ENSAMEG00000016417   Transcript: ENSAMET00000018063
Sequence length 155
Comment pep:known_by_projection scaffold:ailMel1:GL192338.1:1985608:1987594:1 gene:ENSAMEG00000016417 transcript:ENSAMET00000018063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WILETSAVFTSFSPILAQGLTHSGSQKIFVEQQYLNTFYGCPKESCNLFVLKDALKKMQK
FFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPET
VDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFG
Download sequence
Identical sequences G1MDC5
ENSAMEP00000017353

Jump to [ Top of page · Domain architecture · Domain assignment details ]