SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294927842|ref|XP_002779186.1| from Perkinsus marinus ATCC 50983

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294927842|ref|XP_002779186.1|
Domain Number 1 Region: 1530-1668
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000948
Family Retroviral integrase, catalytic domain 0.018
Further Details:      
 
Domain Number 2 Region: 705-853
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000145
Family Reverse transcriptase 0.0088
Further Details:      
 
Domain Number 3 Region: 975-1214
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000289
Family Reverse transcriptase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294927842|ref|XP_002779186.1|
Sequence length 1915
Comment gag/pol/env polyprotein, putative [Perkinsus marinus ATCC 50983]
Sequence
MVVPSDRINESELRVILKGTTDLGNSWRRKGHQPFIGGEDSRLALTTLLREWSKHVEQEW
RTIDHPEAVRAFHASAISGDLSEEIKRAATREATVGKDTRTYTYHRELWSATIAYLNKFH
SRTVHITALIQKVLGEKQGQADIFTYLDGIRRALLELAYEGNGSGAQIHAFHINAAVRNN
LNSPYNAWWYETVGTILSSSLKKCIDTISYEDIQEAIRRVKEKALSLGHLRQPGTDAPSQ
PTRWPATFQVATSTSSSTSVNAVAPSLAATTVALKEPPVTKESPSEHRPRVKATCFRCFS
SEHQTVACDEERPHKENRRCKCGSFRHPVSSCKLEKAGSLSCERCESKDHRSGMCPYSLV
DIRKGEHKKGPGNKGNATNVVFSPDLPLVALEDPSSLSMTFHVGQIEHDTLHFNRSGPVC
TELVIGQSPHAKTVKAVLDSGAGYNYAQPAILEALGSCVQWLKPEGEHAIQAVGVSGEMM
PTNRVAIVSVSSPKRPHDVHRLRFLCPETLLPTMLLGVEGLKTLRIGMTFDASGVHAYSG
VDPEQALVREEETRPQELPRADTDDIIACVSSMECDTQLCIFDTVNFLGAVADSTFTECG
LDHDYSFELYATAAGNLPLLSNKLDLKEALPLERALDNPHCSFRGTYADELQLDSDGMLS
VSCTRFLHDFSWYEDSDRLTPTDGNLTFAKSHAYKLAKSLKRRGLLSAYTNTFEEYLSRG
YIQPLEAPTDQAYFTPHFPVIKGKKTPDGEVGRCTAVRPVFDWRVGNQAQKAGVNIDRGT
WECVAYSRLYKYCIWADLKAAFLNCRVPERTMLTMAFVLANIEGHEDAPTYRYFQFLGPA
MGISGSPAVLQLSGSIMIAESNERTAARLTGRLDDPEAYPIKLALDGACLATPEERHGLH
PKELSLQRPSEAARTLRRAVLKVEDANLRLLRGSSSWVASSTATTAEDGDDLLKNTMEKR
IALCTHSYLNHSARGRYMDDYVVAADSQREAETMYDEDGQVTKSRGQHFSEKKTKRSWDP
TVAEGLGIIWTAKDEFLPRPVDTSLYASETLTVRGLLSAVHTCYDVLGHASWILLKLKKI
LRCCFVAGLQMDSRLSPGDRDQACSLLHLYNETVTTCSVPRYVDVSEAVFLYTDAAMSGY
GMVIAGTDVGNPYLCSARLPPLPSSSYSIVRKESSAFLWGLQVFCAHMQYFPHSLHRHYY
LCTDSTIVKARVEKVMRMEDGQAAKKLPKGWTSWEWNITNRIVRLIRQIVCAIGPNGVGH
THLIHCPSSHNLADPYSRGIDPHLLDRGAAQQWVEMVRSQHEASREVDHVCCTLSHADLG
TEAQLFDNPGQDAVVFLAASPDADTESDIYSYVVSLQQKDAFTAVCRRIVTGDDSNFDKA
LLESLVKDVPKDERARLKATFEVQSEDGQAVLRLKVGHIASQSDGALYIPSEARNRVLSM
VHVFFCHRPSKYMYHYMLSRYYWKNLSTYVRSFCKSCPACQMAKGTGSFPDTAPKLLSRD
FGANNFIVIAWLGPVSQKEQAPYQGQDPQPRYALHIYDPSRRFNYFGLSPDKSALSARRL
LQSYCWTFGFPLFVTCDADRSFCSAEVMSFAHSVGLKVLPGISYAPFRQAYMERVHKEVW
SSIRAIQLEEKRRNPTMPTTPWYELLPAVAFVLNQSACEEFGYHSPNDLTFTYNPQMPPK
CSGYRPNQQLQIFVNKLESESGDFPLHSATTYQALLKDRRDAFHAAMDEFHRHLDATLYE
NQLKVVGKHRRRHQSTLLKAGTPLWIKASTGFSKLSPRWVGPVLYKAPTSSDQIAEIESL
SGKPMGKVHLSRVKLAHLSMELLEDFKKLEVKSSPASGNSGPEDHSVVNPPQLSPPRHFL
GENETTHLPEIQRSVVPLHLSTGLWIACDTCNIWCEVPEHIYMMSSGTLPFSVVT
Download sequence
Identical sequences C5KWX7
gi|294927842|ref|XP_002779186.1| XP_002779186.1.22384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]