SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_10427464g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10427464g0020
Domain Number 1 Region: 172-220
Classification Level Classification E-value
Superfamily SBT domain 0.00000000929
Family SBT domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_10427464g0020
Sequence length 388
Comment high_confidence
Sequence
MGCADCDDRFPLRTGQGLCRTVANRKFRRAELGLLKMDGKAGPQVASPFXXYEPPLAAKR
CVEPADSAWTRTNWQHQQQQKNPPVYEVSKPNWNANLWDWDSGRFVAKPLPDQKRKLDEP
VKIFLPGKDSSENDPGNLTLKLGGSSYSYADDTNASRQNKRVRSGSPGSSYPMCQVDDCR
TDLTSAKDYHRRHKYVKPIPKLPKHSLGALCNAFVSSAADFIRFKNLMRGREAVDGDSRG
TIGEGGKPSQMKHCPGDXNNNSMEKPSGQSSLDGDQVIQLLNRMNSAFPSSQKVAAPSQG
FDLNIAQSIRSPRADIPKANGNPSAGLTAELLAIFSALTGPSHDALALLRNSLATNLNAN
LKPQHQTLPPPAPAPAPAAAQKPQERDI
Download sequence
Identical sequences MA_10427464g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]