SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_47367g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_47367g0010
Domain Number 1 Region: 208-289
Classification Level Classification E-value
Superfamily SBT domain 6.8e-39
Family SBT domain 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_47367g0010
Sequence length 676
Comment high_confidence
Sequence
MTFCQCGIWSSVHVSAESGLDSTRLDFSKDGLKRGLKARQAEGRPRICVGVVGIERRRSD
GRIGLAALRGGIVCGHQNHALGLLNSSGIRSFDGSNDGMNPPAPPSSFHPGLLYSEMPGF
SAGGFGCGDSRSQLLGMMSMQQQAEHHHHHHKEGGFHDIVKREELCPGDFQARIGLNLGH
RTYFSAEDTAVSRLYKRPRAIPPASQVPRCQAEGCKADLTNAKHYHRRHKVCEFHSKATS
VVTGGVQQRFCQQCSRFHVLAEFDEVKRSCRKRLADHNRRRRKPQTNTIVPAVSSAEAAT
ALKVEDDSNNVSGSCNNTSRGTVQASAAAAAAPVLRTEAQALLNAMSLPLILQNTKGSQM
NNNTNTTTANNNNNPMLQQANSQKVTVANQQYVQQQQSGGGGHKGPNLSLSSSSVGMSLC
NPRQTTAQDYSGLELALPWLRTTSEYSGSNHRPPPAMDNILHPIISHEKSNVEAFSASSV
QNFLPLSGSMSSRELGSSQWMVGSSDSASSLEAGQQMFSLLEPAEHQNRTEEQPQTARPV
EYLSHRHQGGLNNKEPVDGNSEAKFSGMQNSLRPSLILIGLIDEPVELLGLASPKSMPRV
SGTIAVTSAYLILFRQAMRRLHCLIEFRSLAMIIIRAIPLLLNSTLHFSIFCGVKSCNSS
PILDNEAPGLFVLVHE
Download sequence
Identical sequences MA_47367g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]