SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009146 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009146
Domain Number 1 Region: 163-265
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.34e-22
Family Canonical RBD 0.00000357
Further Details:      
 
Domain Number 2 Region: 345-429,459-527
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.07e-20
Family Canonical RBD 0.0000623
Further Details:      
 
Domain Number 3 Region: 37-126
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-18
Family Canonical RBD 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009146   Gene: ENSPSIG00000008234   Transcript: ENSPSIT00000009192
Sequence length 539
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212390.1:426991:493044:-1 gene:ENSPSIG00000008234 transcript:ENSPSIT00000009192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRGSDELLSSSITNGPFTMSNSTPATANGNDNKKFKGDRSPCSPSRVLHLRKIPNDVTEA
EVISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPVTPHLRSQPVYIQYSNH
RELKTDNLPNQARTQAALQAVNAVQSGTLALTGAPATEGGLLPGQSSVLRIIVENLFYPV
TLEVLYQIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHYAKMALDGQNIYNACCTLRI
DFSKLTSLNVKYNNDKSRDFTRLDLPSGDGQPSLDATMATAFGTPGIISSPYAGAAGFAP
AIGFPQAAGLSVPAVPGALGPLTITTSAMTGRMAIPGVTGVPGNSVLLVSNLNADAVTPH
GLFILFGVYGDVHRVKIMFNKKENALVQMADATQAQLAMSHLNGQRLYGKVLRATLSKHQ
TVQLPREGQEDQGLTKDYSNSPLHRFKKPGSKNFQNIFPPSTTLHLSNIPPSVTVDDLKN
LFADTGCTVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI
Download sequence
Identical sequences K7FM86
ENSPSIP00000009146 ENSPSIP00000009146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]