SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012636 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012636
Domain Number 1 Region: 674-747
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000105
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 2 Region: 1012-1092
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000298
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 3 Region: 900-989
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000708
Family Canonical RBD 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000012636
Domain Number - Region: 422-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0013
Family Classic zinc finger, C2H2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012636   Gene: ENSPSIG00000011267   Transcript: ENSPSIT00000012697
Sequence length 1579
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209716.1:518236:595098:1 gene:ENSPSIG00000011267 transcript:ENSPSIT00000012697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKIAMCSPRGNLQQRPRAPNPPGSKPHGAFRGAGIAGFQRKPVPGTPQGISQRFIGHETL
QRTGPRRTNVQVTQHRLDPRQAKEMANLQNEPKEKVRTSRWDNNPCSTGNTSRKHSASTR
ITEQHTNVQSRYTTESASSILASFGLSNEDLEELSRYPDDQLTPENMPLILRDIRMRKMG
HQLPNLHSQSREKETIGGTGGSAVKSKVIDYGHTSRYGYSDDPLEMSEYNPEQPTEENRK
EFQPQESLSVPTSNVSCNPMFPMEELMKQMGFHTDSSNTQSFFSVDSASKVPGLCLTPTG
LPVVKPMTSVMTSVQQSLAQPSMSQSVMPPITHPPFSAELLAAVRQHERIQRDSETNQSN
AHIGSGQKNFQSQVEGPIKSPFGVVKASWLPVFSQAAAQKIKRLPTPSMMNDYYATSPRI
FPHMCSLCNVECTHMKDWIQHQNNPAHLESCRQLRQQYPDWNPEAHSSKRNEGDRKENQT
PKRRSNSASPGPRHSRGSGSGHVLRRSRSRSRSPGRFRLARPRSRSPRQMRRLSPRHRSR
SPQRSRNPLRSSPRPQRSASNEWASRRTARSPDKKAALEAVVKSLGASFVAEFNKQKSLQ
AAGQGSSGIGKASPARGMSGVGKVPGTMKKPLNATGHHKTLKKDLSSVPGSSASKMKSET
ADAQEKKLLREKLLSCGTVLHITDLPDDGFSDQDIKKIVQPFGKVSDFLVLRSRNEAFLE
MNYKEAVVAAVKYGETAPVLVNGKRVKKLQVKVSVKKMTQSIKKAALSTKKEGNSATIKK
IKSATAAASAVTSAKLTKTGQTTTRAVKLAEAKKKDTKTKKVADPKRTVENKTTAESKKA
VEARKTTECKKAGQDEVKEISKPVTVQENLDAKSIVEVKTTESTKKENVSKTTAEVTKSE
EPTEPASKELDDICVVVISNLPDKGYSVEEVSNLTKPFGGLKDVLILSSHKKAYLEITQK
SADSMVKFYTCFPMSVDGNQLCISMAPEYKNVKDEEAIFTAMIKNANLKVNTETLYNQFV
HLGNLPDEGYTELEVVCVGLRFGKVDHYVVLKNKKKAILQLDSPDSAKSMCCFLKQYPYN
MGENTLTCMLSPRIEPAEVSTNYCPPLDTFSSDLKKNPEGSGVVQTAAANPPVEPSVAKE
EIISNSVKAETSAVQIEASELDPERTVCDSTTKPLEVETSKGESEVAITGSATKPDDDEL
PQVKSEEIHRKEEVVKDNSEIELLTSALPTVEEKETKVKLEELNAVSDAVETKLEIPVAN
VVVSLEKPEKPAAKVGAALEKKLEKSVAKIGTAIEKKLEKPVASIGMDREKKSEKPVANV
GTDVEKKPEKSVADIGTDIENTEKKVLNEKNEKTSIKVHQNKGPGQVKIDETSKASTSAA
TFVSIKEPTSVSKTILKAVVSIPDISNKTEEQKASSKPETRSRSATEKKLSSKEVGQLRA
TGSRSSLPDSAKSKLDMSPVVVKGGSGRSPSQQDKDSRVESRGSSKQSQERESRSSSMKK
DDNSNKVPAGRISRNSKTGSSDSVKPKEEEELFPFNLDEFVTVDEVVEETDSPVPVRRNP
PRGKRKDSAKNSSTFEPVS
Download sequence
Identical sequences K7FX76
ENSPSIP00000012636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]