SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019165 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019165
Domain Number 1 Region: 80-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-27
Family Canonical RBD 0.0000676
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-25
Family Canonical RBD 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019165   Gene: ENSPSIG00000017029   Transcript: ENSPSIT00000019255
Sequence length 253
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205198.1:1959574:1974937:1 gene:ENSPSIG00000017029 transcript:ENSPSIT00000019255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQK
EHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNK
TNKRRGFCFITFKDEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFVGR
ARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSPGYGGYGGYDYTGYNNYYGYGDYSKVLFV
VLKVENLLLWMLL
Download sequence
Identical sequences K7GFV4
ENSPSIP00000019165 ENSPSIP00000019165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]