SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428212529|ref|YP_007085673.1| from Oscillatoria acuminata PCC 6304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428212529|ref|YP_007085673.1|
Domain Number 1 Region: 682-991
Classification Level Classification E-value
Superfamily TPR-like 4.36e-64
Family Tetratricopeptide repeat (TPR) 0.00024
Further Details:      
 
Domain Number 2 Region: 545-715
Classification Level Classification E-value
Superfamily TPR-like 7.59e-36
Family Tetratricopeptide repeat (TPR) 0.0029
Further Details:      
 
Domain Number 3 Region: 286-492
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.56e-25
Family Prokaryotic proteases 0.0043
Further Details:      
 
Domain Number 4 Region: 36-232
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-24
Family Prokaryotic proteases 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428212529|ref|YP_007085673.1|
Sequence length 1049
Comment hypothetical protein Oscil6304_2088 [Oscillatoria acuminata PCC 6304]
Sequence
MVINKPSEMLLVGALLLLTPTLHSCQILPSISQPQINPNLSPEELHQLASAITVKVIGGE
SAGSGTIIRKVGRTYTVVTNQHVLQAVQGTSKYRLETNKEDELISVANIRIQTSDGLDYP
ATIVRGENINFQDNDLGLLEFNADKTYDVGTFPKSDLALKPGEKVWAAGFPAESPTPTSI
VTEGTVSLIPDQALEQGYQLGYSNPIQNGMSGGPILNRQGDIIGFNGRQGNPLFGDPFVY
ANGDRPTDRERQKMVGLSWGLPVSVLAEAAPAMMKEAEPSLTGVAKQVYDNAKAVTVRIE
ARDKKYPSLDPIPGSGVIIAKQKNTYYVATARHVVESSGQNYELIAPDGRRYRIDYSKIK
QQDGQDVALVQFISNEIYSIATLADYRVKEEERPWVFTAGWPKGESLRNRYFEFTPGFLF
SSEQSSLAAQNTASLTQGYEMVYTNSTQGGMSGGPVLDIQGRVVGIHGRAESGEFGGVQL
GRSLGIPANTLLGSLQVWGIEREWLQVETDPPPELDIHKDIHKFVDMIAALAVTQKTAPK
QDATARDWINYGNQLWRVGRSEQAIEAFNQAIHLNRNSYAAWYARGLALSAADRDREAVW
SFEQAIVIDNTPHEAWREQGKSLLFLKQYPQALASIDQAIQRQNQDAVLYMFRAGILSAL
NRYQEAVAAYTIAIDITPHSWAYNNRGAIRKDLGDVQGAIDDFNQAIKINPQNTNAYYNR
GNARKESGDWQGVIADYTKAIDLNPQYADAYNNRGVARKDSGDLSGAIADYTKAIELNPL
YAGAYYNRGYARKDSGDLSGAIDDYNQAIKINPQDAEAYVRRGIARAHSGDLPGAISDFT
ETIKINPQYALAYNNRGNARKDSGDLAGAIDDYNQAIKINPQLALAYNNRGNARRNSGDL
SGAISDFTEAIKINPQYADAYYNRGVASSILEDMPGAISDFTEAIKINPQYADAYLNRGI
VSSMSEDMPGAISDFTEAIKINPQYADAYYNRGVARYLSEDKQGGIEDIQKGEQLLCQQG
KPECQQAKDALKQIEVGRSGVGQKNNLIE
Download sequence
Identical sequences K9TH78
WP_015148397.1.29528 gi|428212529|ref|YP_007085673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]