SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386358967|ref|YP_006057213.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386358967|ref|YP_006057213.1|
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.14e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000211
Further Details:      
 
Domain Number 2 Region: 228-423
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 7.45e-60
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000587
Further Details:      
 
Domain Number 3 Region: 540-700
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.03e-42
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.047
Further Details:      
 
Domain Number 4 Region: 440-539
Classification Level Classification E-value
Superfamily Translation proteins 3.5e-17
Family AlaX-M N-terminal domain-like 0.012
Further Details:      
 
Weak hits

Sequence:  gi|386358967|ref|YP_006057213.1|
Domain Number - Region: 787-831
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0978
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386358967|ref|YP_006057213.1|
Sequence length 868
Comment alanyl-tRNA synthetase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MPSASLIADDPTLLLVNAGMVPFKPYFLGEVKPPYARATSVQKCVRTPDIEEVGKTTRHG
TFFQMCGNFSFGDYFKEGAISYAWELLTTPQAAGGYGLEPEKLWITVYEDDDEAEQIWRD
VVGVPAERIQRLGKKDNFWSMGVPGPCGPCSEINYDRGPAFGPEGGPAVNDERYVEIWNL
VFMQYERGAGTSKEDFPILGDLPAKNIDTGLGLERLAMILQGVNNMYETDTLRVVIDKAT
ELTGVRYGDGHDSDVSLRVVADHLRTSAMLIGDGVTPGNEGRGYVLRRIMRRAIRNMRLL
GATGPVVHDLLDVVLNTMGQQYPELLVDRKRIETVALAEEAAFLKTLKAGTNILDTAVTE
TKAKGASVLPGDKAFLLHDTWGFPIDLTLEMAAEQGLSVDEEGFRRLMKEQRERAKADAR
AKKTGHADLSAYREVADNSGATVFTGYTDHEGESTVVGLLVDGLPSPAATEGDEVEVVLD
RTPFYAEGGGQLADTGRIRTGTGAVIEVRDVQQPVPGVTVHKGVVQVGEVTVGAGAHAAI
DLVRRRAIARAHSATHLTHQALRDALGPTAAQAGSENAPGRFRFDFGSPSAVPGTVLNDV
EQKINEVLARELDVTAEVMSMAEAKKQGAIAEFGEKYGERVRVVTIGDFSKELCGGTHVH
NTAQLGLVKLLGESSIGSGVRRVEALVGVDAYKFLAREHTLVSQLTDLVKGRPEELPDRV
SGVLAKLREAEKEIERFRAEKVLAAAAGLAESAEDVHGVALVTGRVPEGTGADELRKLVL
DVRQRITGGRPAVVALFTVANGRPLTVIATNEAARERGVKAGELVRTAAKTLGGGGGGKD
DVAQGGGSDPSAVDEAVEAVRRLVAEKA
Download sequence
Identical sequences G8X3T6
gi|386358967|ref|YP_006057213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]