SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSSSCP00000000385 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000385
Domain Number 1 Region: 282-475
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-56
Family Hemopexin-like domain 0.00011
Further Details:      
 
Domain Number 2 Region: 104-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-44
Family Matrix metalloproteases, catalytic domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 23-90
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000173
Family MMP N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSSSCP00000000385   Gene: ENSSSCG00000000368   Transcript: ENSSSCT00000000391
Sequence length 543
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:22759690:22765948:-1 gene:ENSSSCG00000000368 transcript:ENSSSCT00000000391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQQLWLGFLLPMTVSGQAPGPGEKEAAVDYLLQYGYLQKPLEGSDDFRPEDIMEALRA
FQEASELPVSGQLDDATRVRMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPST
LPPYVARAALLQAFQYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNNFDGPGRVLAH
ADIPELGSVHFDEDELWTERSYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRP
HFKLHPDDVAGIQALYGKKIPEMEDEEEETELPTVPPVPTQPPPMPDPCSGELDAIMLGP
RGKTYAFKGNYVWTVTDSGLGPLFQVSALWEGLPGNLDAAVYSPRTQWIHFFKGNRRDKV
WRYVNFKMSPGFPKRLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELAQMDFSSYPKP
IKRLFTGVPDQPSAAMSWRDGRVYFFKGKQYWRLNRQLRVEKGYPRDIAHNWMHCHPQNS
DPTPLDGDTSSSATETTLDTTSSATDIPLNTDSSPRDAVLDIIPSATVSTTHSFPGNVTL
TEA
Download sequence
Identical sequences F1SPJ1
ENSSSCP00000000385 ENSSSCP00000000385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]