SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSSSCP00000000385 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000385
Domain Number 1 Region: 282-475
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-56
Family Hemopexin-like domain 0.00011
Further Details:      
 
Domain Number 2 Region: 104-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-44
Family Matrix metalloproteases, catalytic domain 3.25e-05
Further Details:      
 
Domain Number 3 Region: 23-90
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-14
Family MMP N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
growth factor receptor binding 1.996 15.08
cytokine receptor binding 2.034 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
clathrin-coated vesicle 1.877 7.82
coated vesicle 1.745 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSSSCP00000000385   Gene: ENSSSCG00000000368   Transcript: ENSSSCT00000000391
Sequence length 543
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:22759690:22765948:-1 gene:ENSSSCG00000000368 transcript:ENSSSCT00000000391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQQLWLGFLLPMTVSGQAPGPGEKEAAVDYLLQYGYLQKPLEGSDDFRPEDIMEALRA
FQEASELPVSGQLDDATRVRMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPST
LPPYVARAALLQAFQYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNNFDGPGRVLAH
ADIPELGSVHFDEDELWTERSYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRP
HFKLHPDDVAGIQALYGKKIPEMEDEEEETELPTVPPVPTQPPPMPDPCSGELDAIMLGP
RGKTYAFKGNYVWTVTDSGLGPLFQVSALWEGLPGNLDAAVYSPRTQWIHFFKGNRRDKV
WRYVNFKMSPGFPKRLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELAQMDFSSYPKP
IKRLFTGVPDQPSAAMSWRDGRVYFFKGKQYWRLNRQLRVEKGYPRDIAHNWMHCHPQNS
DPTPLDGDTSSSATETTLDTTSSATDIPLNTDSSPRDAVLDIIPSATVSTTHSFPGNVTL
TEA
Download sequence
Identical sequences F1SPJ1
ENSSSCP00000000385 ENSSSCP00000000385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]