SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSSSCP00000000385 from Sus scrofa 73_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000385
Domain Number 1 Region: 282-475
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-56
Family Hemopexin-like domain 0.00011
Further Details:      
 
Domain Number 2 Region: 104-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-44
Family Matrix metalloproteases, catalytic domain 3.25e-05
Further Details:      
 
Domain Number 3 Region: 23-90
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-14
Family MMP N-terminal domain 0.0078
Further Details:      
 

Protein sequence

External link(s) Protein: ENSSSCP00000000385   Gene: ENSSSCG00000000368   Transcript: ENSSSCT00000000391
Sequence length 543
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:22759690:22765948:-1 gene:ENSSSCG00000000368 transcript:ENSSSCT00000000391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQQLWLGFLLPMTVSGQAPGPGEKEAAVDYLLQYGYLQKPLEGSDDFRPEDIMEALRA
FQEASELPVSGQLDDATRVRMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPST
LPPYVARAALLQAFQYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNNFDGPGRVLAH
ADIPELGSVHFDEDELWTERSYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRP
HFKLHPDDVAGIQALYGKKIPEMEDEEEETELPTVPPVPTQPPPMPDPCSGELDAIMLGP
RGKTYAFKGNYVWTVTDSGLGPLFQVSALWEGLPGNLDAAVYSPRTQWIHFFKGNRRDKV
WRYVNFKMSPGFPKRLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELAQMDFSSYPKP
IKRLFTGVPDQPSAAMSWRDGRVYFFKGKQYWRLNRQLRVEKGYPRDIAHNWMHCHPQNS
DPTPLDGDTSSSATETTLDTTSSATDIPLNTDSSPRDAVLDIIPSATVSTTHSFPGNVTL
TEA
Download sequence
Identical sequences F1SPJ1
ENSSSCP00000000385 ENSSSCP00000000385

Jump to [ Top of page · Domain architecture · Domain assignment details ]