SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000385 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000385
Domain Number 1 Region: 282-475
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-56
Family Hemopexin-like domain 0.00011
Further Details:      
 
Domain Number 2 Region: 104-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-44
Family Matrix metalloproteases, catalytic domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 23-90
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000173
Family MMP N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSSSCP00000000385   Gene: ENSSSCG00000000368   Transcript: ENSSSCT00000000391
Sequence length 543
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:22759690:22765948:-1 gene:ENSSSCG00000000368 transcript:ENSSSCT00000000391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQQLWLGFLLPMTVSGQAPGPGEKEAAVDYLLQYGYLQKPLEGSDDFRPEDIMEALRA
FQEASELPVSGQLDDATRVRMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPST
LPPYVARAALLQAFQYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNNFDGPGRVLAH
ADIPELGSVHFDEDELWTERSYRGVNLRIIAAHELGHALGLGHSRYTQALMAPVYAGYRP
HFKLHPDDVAGIQALYGKKIPEMEDEEEETELPTVPPVPTQPPPMPDPCSGELDAIMLGP
RGKTYAFKGNYVWTVTDSGLGPLFQVSALWEGLPGNLDAAVYSPRTQWIHFFKGNRRDKV
WRYVNFKMSPGFPKRLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELAQMDFSSYPKP
IKRLFTGVPDQPSAAMSWRDGRVYFFKGKQYWRLNRQLRVEKGYPRDIAHNWMHCHPQNS
DPTPLDGDTSSSATETTLDTTSSATDIPLNTDSSPRDAVLDIIPSATVSTTHSFPGNVTL
TEA
Download sequence
Identical sequences F1SPJ1
ENSSSCP00000000385 ENSSSCP00000000385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]