SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSSSCP00000002229 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002229
Domain Number 1 Region: 311-506
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.09e-69
Family Hemopexin-like domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 113-282
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-55
Family Matrix metalloproteases, catalytic domain 0.0000000236
Further Details:      
 
Domain Number 3 Region: 26-96
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74
Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1

Protein sequence

External link(s) Protein: ENSSSCP00000002229   Gene: ENSSSCG00000002039   Transcript: ENSSSCT00000002281
Sequence length 580
Comment pep:known chromosome:Sscrofa10.2:7:81413668:81425248:-1 gene:ENSSSCG00000002039 transcript:ENSSSCT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPVRSLLLPLLTLASALASLSSAQSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLS
AAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHN
EITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFA
EGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELG
HALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGFPTKMPPQPRTTSK
PSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWR
GLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWM
PNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNK
YWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAV
VLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences F1S9C6
ENSSSCP00000002229 ENSSSCP00000002229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]