SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002229 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002229
Domain Number 1 Region: 311-506
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.09e-69
Family Hemopexin-like domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 113-282
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-55
Family Matrix metalloproteases, catalytic domain 0.0000000236
Further Details:      
 
Domain Number 3 Region: 26-96
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSSSCP00000002229   Gene: ENSSSCG00000002039   Transcript: ENSSSCT00000002281
Sequence length 580
Comment pep:known chromosome:Sscrofa10.2:7:81413668:81425248:-1 gene:ENSSSCG00000002039 transcript:ENSSSCT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPVRSLLLPLLTLASALASLSSAQSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLS
AAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHN
EITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFA
EGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELG
HALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGFPTKMPPQPRTTSK
PSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWR
GLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWM
PNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNK
YWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAV
VLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences F1S9C6
ENSSSCP00000002229 ENSSSCP00000002229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]