SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSSSCP00000002229 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002229
Domain Number 1 Region: 311-506
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.09e-69
Family Hemopexin-like domain 1.18e-05
Further Details:      
 
Domain Number 2 Region: 113-282
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-55
Family Matrix metalloproteases, catalytic domain 2.36e-08
Further Details:      
 
Domain Number 3 Region: 26-96
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Protein sequence

External link(s) Protein: ENSSSCP00000002229   Gene: ENSSSCG00000002039   Transcript: ENSSSCT00000002281
Sequence length 580
Comment pep:known chromosome:Sscrofa10.2:7:81413668:81425248:-1 gene:ENSSSCG00000002039 transcript:ENSSSCT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPVRSLLLPLLTLASALASLSSAQSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLS
AAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHN
EITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFA
EGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELG
HALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGFPTKMPPQPRTTSK
PSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFWR
GLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWM
PNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNK
YWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAV
VLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences F1S9C6
ENSSSCP00000002229 ENSSSCP00000002229

Jump to [ Top of page · Domain architecture · Domain assignment details ]