SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|50180|e_gw1.4.3313.1 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|50180|e_gw1.4.3313.1
Domain Number 1 Region: 201-375
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 2.09e-51
Family Functional domain of the splicing factor Prp18 0.00025
Further Details:      
 
Domain Number 2 Region: 149-187
Classification Level Classification E-value
Superfamily PRP4-like 0.000000000111
Family PRP4-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|50180|e_gw1.4.3313.1
Sequence length 383
Sequence
MDFASLMSQEISKAKGGSGSGSGSGSSTGGGEQKKYISRREAEEARRAAYLAEQKRLEEE
RAAKAAAKRRREEEAAQEARAREEKRRRLAEEARLRREAKEAEEERARRRRLGLPEVPLV
KQGEEEGGEGDKKKAEEGGDEDDLDGDGEDAGDIAEEELVKKLRELGEPAILFGENHAAR
LMRYRKVSRGGALAAAAGPIATTLVPVEEKDMKVPDKVPPASDKKARRFLYRQLASYFNM
VLREWEAALARENNADTFAGQAARNAMTSSKDSMRPLFRKFEQGNLDESILEAIVEIVKA
AQERRYVDANDGYLRLSIGKAAWPIGVTMVGIHERSAREKLHGGERGHIMGSEVTRKYLQ
SIKRCLTFAQVRWPPEDIRQLMG
Download sequence
Identical sequences G2QEH4
jgi|Spoth1|50180|e_gw1.4.3313.1 XP_003663002.1.50100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]