SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414075607|ref|YP_006994925.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414075607|ref|YP_006994925.1|
Domain Number 1 Region: 505-674
Classification Level Classification E-value
Superfamily TPR-like 1.21e-40
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 2 Region: 268-449
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.35e-30
Family Prokaryotic proteases 0.015
Further Details:      
 
Domain Number 3 Region: 4-210
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.24e-27
Family Prokaryotic proteases 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414075607|ref|YP_006994925.1|
Sequence length 681
Comment hypothetical protein ANA_C10307 [Anabaena sp. 90]
Sequence
MKLHKLSHLLLFFVLLFPASPIIITGCNSSLFARKPGTLSESELKDVLKEITVKVLVDDK
EAASGTIIKKQNGFYTVLTNYHVIENAKSVKVVTPDNQIYPVEFSKVDRQDNKKDDLYDL
AKLTFSSETTYLVAGLGEENIKPGEKVFAGGYVKGNLQTTKGTAKLFLNQPLIKGQQIAY
DNDIQQGMSGGAIINEKGYLVGINSKLANPVLQTDFRYLQGEQPDEKTLKEWGNYSWGIA
VNLVDEAAPDLALFPERVIRKIGGIPAKVLDIAKQSSVQIKQANGGIGSGVIIAKDNDIY
YVLTAAHVVENKQEYQVVAPDKQVYKVDNQTIRTRQGLDMAVLQFRSSQVYQVATLGDYK
LSDKAQYVFLYGWKGEELNHPSLFSVGTIETNTDFWAKPRGYELAYSNQGYPGMSGGGIW
DTEGRLVGIHNFAEKDVLGYSLGLSIESFLFYQKDGLWQLPQAKLTVAKIEPKSSDFNSI
NLAFFPNISAPDPVNGSGKDWLNYGIQLWRIADIDNVIAAMENAIGKDPNSWQAFYNVAW
IWRGQKKYDQAIADFTQAITINPQFAAAYYNRGVAYSKQGKTELAIADYTQAIIINSKYE
NAYYNRGNAYSKQGNLDQAIQDYTQAITINPLNRKAYYGRILTYILKGNKQEAIKDLETA
KQLFQQQGNTQNAQKTQELLN
Download sequence
Identical sequences K7VWK9
gi|414075607|ref|YP_006994925.1| WP_015078276.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]