SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414078285|ref|YP_006997603.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414078285|ref|YP_006997603.1|
Domain Number 1 Region: 535-814
Classification Level Classification E-value
Superfamily TPR-like 8.72e-52
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Domain Number 2 Region: 978-1213
Classification Level Classification E-value
Superfamily HCP-like 2.88e-50
Family HCP-like 0.0062
Further Details:      
 
Domain Number 3 Region: 1166-1312
Classification Level Classification E-value
Superfamily TPR-like 1.87e-39
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 
Domain Number 4 Region: 35-251
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.94e-29
Family Prokaryotic proteases 0.0037
Further Details:      
 
Domain Number 5 Region: 906-1010
Classification Level Classification E-value
Superfamily TPR-like 2.98e-28
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 6 Region: 271-496
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-27
Family Prokaryotic proteases 0.0067
Further Details:      
 
Domain Number 7 Region: 782-881
Classification Level Classification E-value
Superfamily TPR-like 1.57e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414078285|ref|YP_006997603.1|
Sequence length 1342
Comment hypothetical protein ANA_C13102 [Anabaena sp. 90]
Sequence
MKHLFFTLICTTALLTIPQQLLLISPQPVTAQEPTKKLLTSAKLQALAKSITVKILTKNG
SASGTLIAKNGNNYTILTNDHVMNPGASYRIQTPDGKIYPATVIKEKPASLKNQDVALFQ
FESTAEYTIATLGISAPIAVEQKIVAAGFVSDSAKLVFTEGQISLLPDKSFQRGYRIGYS
NKVQPGMSGGPILNYQGEVIGINAVHAYPISDKIYTYIDNSKPSAAERQQMRQYSWGVPI
YSVAKVVNEVIAKSPKKIDDSALIAKKGLINDIDKIAQEITVLIPNANPTDIGSGVIIAQ
KGNIYYVLTADHVIWNRDEKKLKDKLEIVAPDNQRYAINVSNAKRMPGVDLAVVQFTSNQ
KYQVATLANYSLNTKGQKVFVSGFPGNKQQNKNKLHRILTAGVLSQQQVIKLNTYLSFNN
QRTEKIQTVLSDGYDLLYSNITKKGVSGGAVLDTQGRLIGIHGRAEGEISLDFDGEINLG
SSSGIPIRTFLNLVEQGGIDSDLKVETTVPATLKKSEEDVISEYLLPLDQVPKNSDNEIS
WLNYANQLWRSQKYAEARKAVNKAIAKKPDFYQAWYFKGVIFDSEKKYPESIAAYDKALK
INPNFAQAWKDRGRLLFTLDKYSEALTSFDKAITLSPNQFDLYYWRGFTLHYLKRFPEAI
EAYNQSIKINPLFKFAYNVRSFSYVELKNYRQAITDLTQAIQLDPKDAVSYNFRGLLYGQ
LEEYKQSIADSTQAIQLDPKNAKYYNSRGIAYEGLKEYKQAINDYTQAIQLDPKNAKYYN
SRGIAYSQLKDYKQVIADYTQAIQLDPKDATYYGMRGGAYSELKDYKQAIADYTQAIQLD
PKDAIYYSLRGLAYSKLKDYKQAISDLTETIRRDPKNAPYTMQGLRYSEFKDIKGFLSGY
TGFMSTVYRTRGGIYYELKEYKLAIDDYTQAIKIDSQNANSYAIRAGIYYKLKEYKQAID
DYNQVIQIDPQNATYYGARGFAYFKLKEYKQAINDWSQVIKFDPKDATYYGLRGNTYLLS
KEYRQAINDYTQAIKIDPKNANYYSGRGIAHHFLEDYKQAIDNYTEAIKIDPKKIINLRG
AAYLQLKEYKLAIDDYNQAIQLDPKNAIYYGTRGDAYLQLKDYKQAINDYTHAIQLDPKN
AIYYGTRGFAYLQLKDYKLAINDYTQAIKIDPKNATYYSARGDAYFQLKDHKQAIDDYTQ
AIKLKPDFTEAYYVRGIAHYFLKDYKQAIDDWNQAIKLKPDYPEAYTNLGIVSYEMGEVE
TAINYWRNAIKINSNFAEAHLALGVALYGKGDQEAGLKSAETALKLDKRYGKIEFLKENG
WGEKLIKDSQEFLNNPRIKGLI
Download sequence
Identical sequences K7VZU0
gi|414078285|ref|YP_006997603.1| WP_015080936.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]