SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|342164298|ref|YP_004768937.1| from Streptococcus pseudopneumoniae IS7493

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|342164298|ref|YP_004768937.1|
Domain Number 1 Region: 1081-1244
Classification Level Classification E-value
Superfamily Cell wall binding repeat 3.3e-46
Family Cell wall binding repeat 0.00000996
Further Details:      
 
Domain Number 2 Region: 497-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.66e-20
Family Prokaryotic proteases 0.0081
Further Details:      
 
Domain Number 3 Region: 60-288
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.56e-19
Family Prokaryotic proteases 0.0062
Further Details:      
 
Domain Number 4 Region: 305-348
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0000844
Family Cell wall binding repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|342164298|ref|YP_004768937.1|
Sequence length 1245
Comment sialidase A [Streptococcus pseudopneumoniae IS7493]
Sequence
MFLYLKGLGKFRKSKAYGLVGCLALVSMIGLSIPDLPVVGGRTVYADVIQGGDDIKDVSV
HEKSAEGVAMTYTTYDSGTSGKQTASGSGVFVAPNVMVTVAHNYYDKNQENKSAVLRGGE
SARSYVVMNSETEKNNKVPTSGVSEALEKDSIHLYNGNDFGKDYSNDLAVVVTKKPVEAM
TGGEDSPRELSHKEVSTGDKITMVGYPNDFSTPNLSEENKKRLKDGKAYSVSTTVSSVNK
ESGAVTYHSSALGGFSGAPLFNDKGDVVGIHQHGTNTSNAPESERIGGGTIFTEKHRAWI
RSMIDKYGIKGWYIDGANRYYYDENHRALKDVEYEIDGALYRFDEKGRATLVKGEEKGRV
LLRVEDTKGTPLISDKVVQEGPVGSGLNFHLRQNPDFKQLIATSPTAKVVSYNGVSVNKL
VSDTSWSDEYVSKLALGNTIIKAVVDSVNPSSTSSSDFARTEVGKVDLSGKSNLPMPSKE
VLQAPNGSENFYATTHIQTPDGSGSGTLIAPNLVLTVAHNFLTVKGSEVVTKSGRTNTVY
KATLPNGLSVHFSDDDIVYWNKKDSVFGFKNDLALVRLKEDFKAVSPVEVVSESTSIAKG
EKVSVYGFPDGRLSPVLDSEVVDTTDFGSGVEGISYEGTKPGASGGGLYNDKGTLIGVHQ
NGVVGSRSGGLVLSKEQLDWVRSYIEGKPKEPVYVKDEVLVDEKDKDKLPSTPKDEKPST
PKIESDKDKVEPPLKPQKEPKTEVITTYEGDSTLEVGKERTEDTKGEKEGVPLIYRVVYK
GTKPKVEKESIAFDTLYQGDETKELGFRSVVEGKGGVVTRTTTYQVDKYTGAVSSQVSEK
KIAPQSKVITLGIKPNSVIKELPITERFEDSEELEKGKTEVVSEGYVGKEVTKVTYKVLA
DGKIVENSRTVEVTPMKERVVLKGVKEVVSSTEENSSNLKEEVVSPDKVEFPVPKDAPIR
EELPASSEEFSESEVLVSGEKIPGDLGKSIVSSKELVPERVEVPDFVAKVTGGEKLTVEG
HRDERKIKTPSKQERLSSPETTAQFTTNGTGSSSLTAVFGVEADNMSLSTVEHSVITYNQ
QRGWHKINNQWYFRNSDGKERTGWMKENDAWYYFDANGIMQTGWIQDTDGNWYYLKDNGM
MEVGWFQDSSGAWYYLGSSGSMESNTWIYYKGKWYYLGSSGSMESNTWIYYKGKWYYLGS
SGSMESNTWIYYKGKWYYIDAFGKLLFNSLTPDGYRVNEYGEWIN
Download sequence
Identical sequences G0IC28
WP_000480565.1.16488 gi|342164298|ref|YP_004768937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]