SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289167449|ref|YP_003445718.1| from Streptococcus mitis B6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289167449|ref|YP_003445718.1|
Domain Number 1 Region: 1003-1108,1195-1455
Classification Level Classification E-value
Superfamily Sialidases 1.37e-81
Family Sialidases (neuraminidases) 0.0000265
Further Details:      
 
Domain Number 2 Region: 784-965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-25
Family Leech intramolecular trans-sialidase, N-terminal domain 0.0097
Further Details:      
 
Domain Number 3 Region: 48-303
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-20
Family Prokaryotic proteases 0.0088
Further Details:      
 
Domain Number 4 Region: 472-662
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-19
Family Prokaryotic proteases 0.0091
Further Details:      
 
Weak hits

Sequence:  gi|289167449|ref|YP_003445718.1|
Domain Number - Region: 305-348
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.000144
Family Cell wall binding repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289167449|ref|YP_003445718.1|
Sequence length 1907
Comment sialidase A (neuraminidase A) [Streptococcus mitis B6]
Sequence
MFIRLKGLGKFRKSKAYGLVGCLTLFAVLGLAAPELPVIGGGVAYADVIQGGNDIKDVEV
HSDAANGVAMTYTTYDSGNSGQQTASGSGVFVAPNVMVTAAHNYYEKKTEDGSAVLRGGD
SAKSYVVMNSDTEKINKVPTSGSTEAVAKESIHAYNEKDFGKSYGNDLAVVVTNKTVEAM
TNGEDSPRELSKTEVATGDSIRMVGYPNDFSTSNLSEENRNRLKDGKPYEVEGKVSTLNK
ENGAVTYHTSALGGFSGAPLFNDKGEVVGIHQHGTNTASEVEANRIGGGTIFTEKHKEWI
RSMVDRYAITGWYLDGTIRYYYDENHKALKNVEKEIDGARYRFNDRGQATLLSGVEKGRV
LLRLEDVKGNRLIADKVVQTGEVDSPIVFNLRQDSDFNRLVGDSPNAKIVSYNNLPINKL
VTDTSWSGDYVSKVALGNTVIKAVLDSVAPKTDFARTEVGKVDLSGTANLPKPSEIVKNA
PNGEQNFQATTHILTPDGTGSATLIAPNLLLTVAHNFLTVNGSKVVTKSGKENTVYKATL
PNGTSINFSDEEIAYWNRAESVFGFKNDLALVRLKEAVQGVTPVEVVKQSAKVAEGNTVS
VYGFPDNKLSPVLDSKVVGTTDFGSGIEGISYGGTKPGASGGGLYNDKGVLIGVHQNGVV
DNRSGGLVLSKEQLDWVRSYIEGQPKEPVYVKDKEVASSKQDLDKELAEKLASATDNGVE
INKESLKEEKPTNQEGNSENVPAEPNVEKGEKTENLPEEVESADNVVLPPRDYFARDLKN
VKTVFEKEDLATNAGNGQRVDLAEALDKLKHLQNATIHMEFKPDANAPQFYNLFSVSSDK
NRDEYFSMSVNKGTAMVEARGADGSHFYGSYSDAPLKVKPGKWNSVTFTVERPKADQPNG
QVRLYVNGVLSRTNTKSGRFIKDMPDVNKIQIGATRRANQTMWGSNLQVRNLTIYDRALT
SEEVGKRSQLFKVADLEVKLPESAKITEKKEVFVSGVNGGLNKDGINTYRIPALLKTDKG
TLIAGADERRLQFADWGDIGMVVRRSQDGGETWGDRITISNLRDNPDAKDKTAPSPLNID
MVLVQDPETKRIFSVYDMFPEGKAVFGMPAKPEKAYERIGDKTYQILYKTGEKGYYTIRE
NGEVYNSKNQKTDYHVVVNPKKLGYSDKGDLYKGKDLIGNVYFAQSTKNPFKVANTSYLW
MSYSDDDGKTWSAPKDITPGIRQDWMKFLGTGPGTGIVLRTGEHKGRILVPAYTTNSVSH
LGGSQSSRLIYSDDHGVTWHAGEAPNDNRPVGNKTIHSSNMNNGGAQNTESTVLQLNNGD
VKLFMRGLTGDLQVATSKDGGITWEKTIKRYPEVKDAYVQMSAIHTMHDGKEYILLSNAA
GPGRERKDGLVHLARVEKNGELTWIKHHLIQGGEFAYNSLQDLGNGEYGILYEHSENGQN
RYTLSYKKFNWDFLTKDRISPKEVKVKQVSDMGEGIMSLEFDSEVLVNQAPTLSLANGKT
IEFMTQLDNKTLLFAVNKKDIGQEITGIVGGSIESMHDLPVNLRNSGIPGGINSAEVAVN
ELDDYTGAIGTAGEEIATTESLLDYSGGVSSEPVVTPEVDEYSGGVNAVEAAASELDDYT
GAIGTAGEEIATAESLLDYSGGVSSEPVVTPEVDEYSGGVNAVEAAVNELEDYTGLFATP
EETSTVKSTEKQVSNKESKKEEKTNQVIPSLDSSQRLFKNETGSVHIQASEEVLRNVKAV
QIEEVKVSSLSSLNYKAFDIKLKNADGQSVQPKGKVLITFTTDQSVENVYYVDPEGNLHP
LEFTQKDGKVIFGTNHFSIYAMTFRLSVNNLALDNATKDKKEEEIAPLPKLLSTNQHSES
NQSENRVSNNEQTMLPNTGESASLLTILFGFVGVFLGAMISYKRKDS
Download sequence
Identical sequences D3H7K8
YP_003445718.1.36347 gi|289167449|ref|YP_003445718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]