SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11497890|ref|NP_069112.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11497890|ref|NP_069112.1|
Domain Number 1 Region: 1-212,302-346
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.33e-50
Family FAD-linked reductases, N-terminal domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|11497890|ref|NP_069112.1|
Domain Number - Region: 230-297
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00188
Family D-aminoacid oxidase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11497890|ref|NP_069112.1|
Sequence length 354
Comment sarcosine oxidase subunit beta [Archaeoglobus fulgidus DSM 4304]
Sequence
MKVAVIGGGVAGLSAAYFLAKAGADVKVFEQKYLLYGASGRNSGGLTAQFTNEAMIKLAK
RTLELYDELQSEVGFNFLLRRDGYVKIAGKGEEAKLREEVEFQRKAGVKVKMVEPEFVKE
LFPDINTSAFTAASYFADGGVVFPWPVVWGLAKGCRELGVEIYDYTPASVEVKGNDLTVK
ASGESYKVDYIINAAGAWSNEISQQAGVELNNKVFREEICVTESLKPYLDPYIMDISTGV
YFSQSMRGEIVGGILGSETDRLETKASLDFLTTYAKRVTELVPKLRGMAVLRQWAGLYDA
GRNGMPVIGQTKVRGFIQLNGFGRHGMSLALAAGEGVAELIVKGRSSIVEPFKP
Download sequence
Identical sequences A0A075W9P6 A0A101E2D1 O29965
WP_010877785.1.27515 WP_010877785.1.34637 WP_010877785.1.46508 224325.AF0274 gi|11497890|ref|NP_069112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]