SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11498628|ref|NP_069856.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498628|ref|NP_069856.1|
Domain Number 1 Region: 1-156,241-324
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.76e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|11498628|ref|NP_069856.1|
Sequence length 364
Comment bacteriochlorophyll synthase, 43 kDa subunit [Archaeoglobus fulgidus DSM 4304]
Sequence
MDAAVVGGGPAGSLAAILLGKSYDVALFEEHQSAGFPVQCAGLVSDKCYKKLKEHCKAEK
AIENHIKGAFFFSPSGKIVLEGRGEAVVVERKILDRLLFERAAERAKVFVKEKARLNGFR
IITPSREVSAEKIIGADGVNSTVREHFGFPTMGFFTAVQVEAKFEPLDENCVELYFGGNW
SDSFFAYAIPLGDTARIGVVSRSSPLRYLENLMKRHPSVSGRVEGSAVELNAGAIPDRLV
KFSKRDVALIGDAAGMVKPYTGGGLYYHLIAAEKLAESFPDLKGYEKSYLKEMGREYRFG
YAVRKLYSLPDEKLEQLFSAMADFDFRGVHMDSPSTLIRKAADISFRLLRKPSLAFYLVK
SLFL
Download sequence
Identical sequences A0A075WDX8 A0A101DC02 O29239
gi|11498628|ref|NP_069856.1| 224325.AF1023 AF1023_1_364 GR184 WP_010878523.1.27515 WP_010878523.1.34637 WP_010878523.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]