SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11498861|ref|NP_070090.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498861|ref|NP_070090.1|
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.67e-105
Family FMN-linked oxidoreductases 0.000000445
Further Details:      
 
Domain Number 2 Region: 354-629
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.75e-50
Family C-terminal domain of adrenodoxin reductase-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11498861|ref|NP_070090.1|
Sequence length 632
Comment NADH oxidase [Archaeoglobus fulgidus DSM 4304]
Sequence
MKLFEPIEFGGMKVKNRIVLPAVGLNYTTPDGRVTDKLLRFYEERAKGGIGFAVVGIAKI
EPHFFGGIAAHSDEFIPDLKKIADVFHKYDVKCALQLWHPGRYEISFDPNRQPVAPSPIP
PPIFTKRTPKELTKEEILQIEEEFADAAVRAKKAGFDAVELIGSAGYLISQFFSPATNKR
TDEYGGSLENRTRFAVEIIQKIKEKCGESYPVMIRIPGDEFIEGGNTVREMKQIAKILED
AGVVAINVMAGWHESRKPLTTMLVPRGGFAYLAAEIKSAVSVSVIASHRINDPIVAEKIL
QEGKADMVAMLRALIADPELPKKAKEGRFDEIRYCVACNQGCMDMVMQAQPVTCLVNPIV
GREAEFENLKAEKPKKVVIVGGGPGGCMAAEMLARKGHKVVLFEKTDKLGGQLNLAAKSP
LGYEFAEVGKYFMNVLPKLGVEVRYNTEADAGKVLAENPDVAVIAVGASPLIPPIPGVEN
AVTAFDVLAGRAEVGNSVVVIGGGGVGCDVAAELANEGKKVTIVEMLPKIGQDIGISTRW
TVLMYLKEKGVEMLTNTKAVEIKPNAVVVEQNGERKELQCDTAVIAVGTKPNNGLYDELQ
GKVSELYKIGDCVKPRKALDATREGAELALKV
Download sequence
Identical sequences O29006
224325.AF1262 WP_010878757.1.34637 WP_010878757.1.46508 gi|11498861|ref|NP_070090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]