SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11499058|ref|NP_070292.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499058|ref|NP_070292.1|
Domain Number 1 Region: 43-252,363-424
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-44
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0083
Further Details:      
 
Domain Number 2 Region: 441-565
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 5.63e-30
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11499058|ref|NP_070292.1|
Sequence length 575
Comment fumarate reductase flavoprotein subunit [Archaeoglobus fulgidus DSM 4304]
Sequence
MEESRFKISRRQFLALAGAAGVAALGVRFFAGNEPYVERDYTIDSDKFREEFITTDVLVV
GGGMAGLFSAVKAHDAGAKVLMVSKGRLGCSGQTPFAKGFFVFDSKTSPVSLDEFVELVS
QSALGSNNRAYTRQLAMYSKDRAEELRKWGFFDSSLYHEPFRRPIDERGIRVMERIMITH
LIRENGVIAGAAGFSLDEEKLYFFNAKSVVLCTGAGGFKPYGFPIRDLTHDGSVMAYEIG
ARITGKEWNDGHTTSSQYPAACYDSWHGIFENKPSITGVEIHHDLGVELNYATYIRGGPV
SMGGQMAEVSGGPYVPEEFRRAAPSEGRTQGPPERGERPPPGGGGYVVGGASAGMSIHKS
EGLVPINDRCATDIPGLYAAGDALGSHMSGGIYTQIGSSLAGSAVQGAIAGEEAANYAKD
IDLQSIPESTVSRIREEILAPLNRDSGYSPAWVTQVLQGVMVPNFVLYIKKASILSAALA
YVEELRDHHVPMLVARDLHELRLAHETKNMIVNAEMKLRASLFREESRLSHYRLDYPEID
DENWSVWVNIYKGSDGKMKLEKQPFGYWPNGDPIE
Download sequence
Identical sequences O28809
gi|11499058|ref|NP_070292.1| 224325.AF1463 WP_010878960.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]