SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11499802|ref|NP_071045.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499802|ref|NP_071045.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000041
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11499802|ref|NP_071045.1|
Sequence length 88
Comment hypothetical protein AF2220 [Archaeoglobus fulgidus DSM 4304]
Sequence
MKKYDAIVIGTGSAMIIVQGLLSMNPDSRIAVIDKYRPRGICLTRGCIPSKMVISVAEII
ADIEKTRELGVDAEIKSVDFGRIMKRMS
Download sequence
Identical sequences A0A075WGS9 O28063
WP_010879709.1.27515 WP_010879709.1.34637 WP_010879709.1.46508 224325.AF2220 gi|11499802|ref|NP_071045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]