SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11499853|ref|NP_071097.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499853|ref|NP_071097.1|
Domain Number 1 Region: 5-210
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-19
Family HI0933 N-terminal domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|11499853|ref|NP_071097.1|
Sequence length 240
Comment hypothetical protein AF2272 [Archaeoglobus fulgidus DSM 4304]
Sequence
MVAIDYVVIGAGYAGLMCAEALMDKGFKTLVFDMRESGGEIVVFSKLEEFRSKYEKYIEK
IEEIRKDIPVDIGTVIKSKPVIINSGNGLKRYEARRVILATGATDTAPVKLNVLSKKIEG
IYTLENALREISENNKIGEKVLIAAKDDVIVKLAESQLSDLGYDVEISELTNDIQVIGKE
RVEGVEISGVRYSCDTLVVYGGRNPFNPLKLRGTPVGNVVTCTYDYSKVEENVKNFLAKI
Download sequence
Identical sequences A0A075WGZ2 A0A101DD14 O28012
gi|11499853|ref|NP_071097.1| WP_010879761.1.27515 WP_010879761.1.34637 WP_010879761.1.46508 GR182 224325.AF2272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]