SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155867|ref|YP_003560251.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155867|ref|YP_003560251.1|
Domain Number 1 Region: 4-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-115
Family Tandem AAA-ATPase domain 0.00000000296
Further Details:      
 
Domain Number 2 Region: 33-81,459-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.2e-35
Family Tandem AAA-ATPase domain 0.00000631
Further Details:      
 
Domain Number 3 Region: 615-656
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000615
Family C-terminal UvrC-binding domain of UvrB 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294155867|ref|YP_003560251.1|
Sequence length 657
Comment excinuclease UvrABC system, helicase subunit (UvrB) [Mycoplasma crocodyli MP145]
Sequence
MSIYQLRANYKPSGDQPRAIQELSEGVAEGLKHQVLEGVTGSGKTFTIANVIQNFDRPVL
VLSHNKTLASQLYSELKSFFPHNAVEYFVSYFDYYRPEAYIPTSDTYIEKTSKTNQDIEL
LRMSTINSLLRRRDTIVVASVSSIYGALNPQEYQKGIFEIFKGMDFNFKEFLRTLIKIKY
DRNDIDNPPATFAVRGDTVFISPADSDEFLLRIDFFGDTIEAIYKVDKVTKNIIKEFKVY
AIYPGEAYTVENSIFDKILPMIQEELNQRIKYFNENNKLLEAQRISERVKNDMDEMAEYG
FCGGIENYTMYLDGRDFNQRPFTLFDYLPNDTIIFLDESHMMIPQLHGMYKGDRARKETL
VNYGFRLPSALENRPLKFHEFEQAFDFQKIYISATPNEYEIDQSQGLVTKLYVRPTGLLD
PILEMRPTKNQIEDIFDEIKIQNDKNQRTIVLTTTKRSAEELSSYMQKRNIKSAYIHSEY
DTFKRNEILRKLRKGIYDVVIGINLLREGIDLPEVSLVVVLDADKEGFMRNRSSLIQIAG
RAARNKDGRVIFYADVETKSLKATFEDNKEKRELQIAYNKKHNITPQTIYKEIAEPIQGH
DIDNALEAVLAKDKKITKQDKEELIKKIKVQMKQAAKDLDYERAIELRDLIIEIEKS
Download sequence
Identical sequences D5E658
WP_013054472.1.77063 gi|294155867|ref|YP_003560251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]