SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296137947|ref|YP_003645190.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296137947|ref|YP_003645190.1|
Domain Number 1 Region: 79-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000442
Family Prokaryotic proteases 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296137947|ref|YP_003645190.1|
Sequence length 269
Comment hypothetical protein [Tsukamurella paurometabola DSM 20162]
Sequence
MALAFALVGVVSAAGCGLTPSSRPSSPEPSRFTRTEAAATTPSVAPYAVDAPGRTVAVAP
RPTTGAGITTFADSFGFYASVCTLGFFARYPNGQVVAFTAGHCADLARQARPDDAPVARY
LTSASRSTAFGEYIKATRTRRGQDIAIIQVLGADVRAVADAIGPVTGYSTAAELRDGRPE
ICIVGARTGRSCGVFDTIDGRRVTWAGTPAVEGDSGGPVYARWPDGTFTAVGVVNSVHTR
ADGTGTGGGSGTLVADDILANSMTLMGTT
Download sequence
Identical sequences D5UQL8
WP_013124906.1.58240 gi|296137947|ref|YP_003645190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]