SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296138797|ref|YP_003646040.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296138797|ref|YP_003646040.1|
Domain Number 1 Region: 200-403
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.67e-54
Family Prokaryotic proteases 0.0000266
Further Details:      
 
Domain Number 2 Region: 363-390,420-495
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-18
Family HtrA-like serine proteases 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296138797|ref|YP_003646040.1|
Sequence length 497
Comment PDZ/DHR/GLGF domain-containing protein [Tsukamurella paurometabola DSM 20162]
Sequence
MTRAASLFPPGDGERPRLAPRPTHRPSVSEGEQVVFGRPDGVAGSFEPKGRAVDGARPQP
RAAAPDPVLTEAFSRPPGSVDTLQRDPYAGSLEPEPEEEPKDPWRDTDSAASLGEPGLDA
PPRPEPQPDPDKLGVSDVLFGRRIAPTALIVLGSLALVIGLVGGLLGGAIGRITGTTIEK
LTDSRVALPVDDAKIPDQGPYAELAAKLAASVVTLEITTKTDGSLGSGSIIDSRGGYIIT
NHHVVDMAESSKDSKIEVVFSTGRRVPAKLVGSDPGTDIAVVKVDVDGLQQITIGDSDQL
VPGQDVVAIGSPRGLRQTVTTGVVSAVHRPVLEPPQGPGPLVVFDAVQTDASINPGNSGG
PLIDLKGGQIGMNTLIRTESGGSEGLGFAISSNVFQPIAQSIIRGEKVVHADLGLNGKMN
FNDDASGLRVENVKKGGAAERAGIREGDVITKVGDKEVVDYATLAVEIRTVGVGNETTLT
VARDGRQVPIKVTPGPA
Download sequence
Identical sequences D5UVB1
gi|296138797|ref|YP_003646040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]