SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296141067|ref|YP_003648310.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296141067|ref|YP_003648310.1|
Domain Number 1 Region: 56-230
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.27e-21
Family Prokaryotic proteases 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296141067|ref|YP_003648310.1|
Sequence length 240
Comment hypothetical protein [Tsukamurella paurometabola DSM 20162]
Sequence
MQFSVARRLGVVAAASLGAATSVLIAAGPVAAAPNIVIGPGSEIDVVQKETDKGIEVQAC
TLGVMALTPDGRRVGVTAGHCGNAGQTVAVPVPGRDRTIADVGKVERSASPRISDDDRVI
DPNEPDWATLAFKPGVPLTNRQGTVNPRIVGRAVVGDQVCRQGRTTGWQCGRVIDVAGNR
ILSDVRSDHGDSGGPLIRMADGAVLGIATSSFKDGSSAGQSQYLDLGFIFGAAGGLRLAV
Download sequence
Identical sequences D5UWH2
WP_013127971.1.58240 gi|296141067|ref|YP_003648310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]