SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296141993|ref|YP_003649235.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296141993|ref|YP_003649235.1|
Domain Number 1 Region: 84-274
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.51e-28
Family Prokaryotic proteases 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296141993|ref|YP_003649235.1|
Sequence length 294
Comment peptidase S1 and S6 chymotrypsin/Hap [Tsukamurella paurometabola DSM 20162]
Sequence
MRKIVIGAATLALLCLSFLSYTAASPALAAPVENDMVAPIGWKVASGAADVDHPLDSSGL
VNPSGLSETSPSPGSQFDARTIIGPDDRGQIQNTRAFPYRAIGQATYDSGVLIGYVCSAW
LASADTLVTAGHCVHNLFDDGIVRNFAFSPARNGSLNPWGTVQAREIWTDKYYNIKSGRD
WAVIKLAEPIGSTVGWLGMTKSTSISSSLGQQATITGYPADKPYGTQWSASGMIDNETPQ
YLQYTIDTFGGQSGSPLYRSARALGIHVSGTASHNSATKLSEPLFDVIVNLSRR
Download sequence
Identical sequences D5UZ49
WP_013128876.1.58240 gi|296141993|ref|YP_003649235.1| gi|296141993|ref|YP_003649235.1|NC_014159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]