SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000006029 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006029
Domain Number 1 Region: 97-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.68e-57
Family Matrix metalloproteases, catalytic domain 4.13e-07
Further Details:      
 
Domain Number 2 Region: 25-92
Classification Level Classification E-value
Superfamily PGBD-like 5.69e-16
Family MMP N-terminal domain 0.002
Further Details:      
 

Protein sequence

External link(s) Protein: ENSBTAP00000006029   Gene: ENSBTAG00000004594   Transcript: ENSBTAT00000006029
Sequence length 267
Comment pep:known chromosome:UMD3.1:15:6390160:6400322:1 gene:ENSBTAG00000004594 transcript:ENSBTAT00000006029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVLLCAACLLPGSPALPLGPGPGGEGDPRWQLAQDYLKRFYSSDSKIKNANSLEVRLK
RMEGFFHLPITGILSPRIIEIMEKPRCGVPDVAEFSLFPNHPKWTSKVVTYRIMSYTSDL
PHITVNQLVAKAFKIWSEAIPLTFKRLRWGTADIMIGFARRAHGDPYPFDGPGATLAHAF
APGPGLGGDAHFDEDERWTDGIGIGVNFLYVATHELGHSLGLSHSSDPNAVMYPTYSKED
SKNFKLSQDDINGIQLLYGKRNDSRKK
Download sequence
Identical sequences F1MU56
ENSBTAP00000006029 ENSBTAP00000006029 9913.ENSBTAP00000006029

Jump to [ Top of page · Domain architecture · Domain assignment details ]