SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006029 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006029
Domain Number 1 Region: 97-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.68e-57
Family Matrix metalloproteases, catalytic domain 0.000000413
Further Details:      
 
Domain Number 2 Region: 25-92
Classification Level Classification E-value
Superfamily PGBD-like 5.69e-16
Family MMP N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05
endocytic vesicle 1.532 4.85
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96

Protein sequence

External link(s) Protein: ENSBTAP00000006029   Gene: ENSBTAG00000004594   Transcript: ENSBTAT00000006029
Sequence length 267
Comment pep:known chromosome:UMD3.1:15:6390160:6400322:1 gene:ENSBTAG00000004594 transcript:ENSBTAT00000006029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVLLCAACLLPGSPALPLGPGPGGEGDPRWQLAQDYLKRFYSSDSKIKNANSLEVRLK
RMEGFFHLPITGILSPRIIEIMEKPRCGVPDVAEFSLFPNHPKWTSKVVTYRIMSYTSDL
PHITVNQLVAKAFKIWSEAIPLTFKRLRWGTADIMIGFARRAHGDPYPFDGPGATLAHAF
APGPGLGGDAHFDEDERWTDGIGIGVNFLYVATHELGHSLGLSHSSDPNAVMYPTYSKED
SKNFKLSQDDINGIQLLYGKRNDSRKK
Download sequence
Identical sequences F1MU56
ENSBTAP00000006029 ENSBTAP00000006029 9913.ENSBTAP00000006029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]