SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007997 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007997
Domain Number 1 Region: 311-502
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.41e-50
Family Hemopexin-like domain 0.00053
Further Details:      
 
Domain Number 2 Region: 26-92
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000022
Family MMP N-terminal domain 0.0067
Further Details:      
 
Domain Number 3 Region: 119-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000419
Family Matrix metalloproteases, catalytic domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96
Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05

Protein sequence

External link(s) Protein: ENSBTAP00000007997   Gene: ENSBTAG00000006086   Transcript: ENSBTAT00000007997
Sequence length 510
Comment pep:known_by_projection chromosome:UMD3.1:19:14904920:14930074:1 gene:ENSBTAG00000006086 transcript:ENSBTAT00000007997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRVLPLLLWGGLDAQRVGPELRREAEAFLEKYGYLSDQGPSRPSSTQFSNAI
REFQWVSQLPISGVLDPPTLHQMTRPRCGVADTDSQMPWTERVSALFAGRWAKMRRKKRF
ARQGNKWYKRHLSYRLLNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRL
AFFQGDHNDGLSNAFDGPGADTEPLSYRAGGKPPTRRGSLERRQWRVRSSFRFGQAAAPS
RDPSPSAHAYYKQGSRDPQKALAELRSSSSPYQGKPQGGSVAIQLPGKLFTDFEAWDPLR
LQGRRPETRGPKYCHSSFDAVTVDGQQRLYVFQGNQFWEVTADGNVSEPRPLRERWAGLP
PHIEAAAVSLEDGDFYFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDAAFFFPPLRRL
VLFKGTRYYVLAREGLQVEPYYPRGLRDWGGVPEEVSGALPRPDGSIIFFRDDRYWRLDQ
AKLQTTTSGRWATELPWMGCWHANSGGALF
Download sequence
Identical sequences E1BK30
9913.ENSBTAP00000007997 ENSBTAP00000007997 ENSBTAP00000007997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]