SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000007997 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007997
Domain Number 1 Region: 311-502
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.41e-50
Family Hemopexin-like domain 0.00053
Further Details:      
 
Domain Number 2 Region: 26-92
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-15
Family MMP N-terminal domain 0.0067
Further Details:      
 
Domain Number 3 Region: 119-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.19e-15
Family Matrix metalloproteases, catalytic domain 0.00097
Further Details:      
 

Protein sequence

External link(s) Protein: ENSBTAP00000007997   Gene: ENSBTAG00000006086   Transcript: ENSBTAT00000007997
Sequence length 510
Comment pep:known_by_projection chromosome:UMD3.1:19:14904920:14930074:1 gene:ENSBTAG00000006086 transcript:ENSBTAT00000007997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVGLLLRVLPLLLWGGLDAQRVGPELRREAEAFLEKYGYLSDQGPSRPSSTQFSNAI
REFQWVSQLPISGVLDPPTLHQMTRPRCGVADTDSQMPWTERVSALFAGRWAKMRRKKRF
ARQGNKWYKRHLSYRLLNWPQHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRL
AFFQGDHNDGLSNAFDGPGADTEPLSYRAGGKPPTRRGSLERRQWRVRSSFRFGQAAAPS
RDPSPSAHAYYKQGSRDPQKALAELRSSSSPYQGKPQGGSVAIQLPGKLFTDFEAWDPLR
LQGRRPETRGPKYCHSSFDAVTVDGQQRLYVFQGNQFWEVTADGNVSEPRPLRERWAGLP
PHIEAAAVSLEDGDFYFFKGSRCWRFRGPKPVWGSPQLCRAGGLPRHPDAAFFFPPLRRL
VLFKGTRYYVLAREGLQVEPYYPRGLRDWGGVPEEVSGALPRPDGSIIFFRDDRYWRLDQ
AKLQTTTSGRWATELPWMGCWHANSGGALF
Download sequence
Identical sequences E1BK30
ENSBTAP00000007997 ENSBTAP00000007997 9913.ENSBTAP00000007997

Jump to [ Top of page · Domain architecture · Domain assignment details ]