SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000017168 from Bos taurus 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017168
Domain Number 1 Region: 362-559
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-69
Family Hemopexin-like domain 7.93e-06
Further Details:      
 
Domain Number 2 Region: 136-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-52
Family Matrix metalloproteases, catalytic domain 5.13e-07
Further Details:      
 
Domain Number 3 Region: 53-116
Classification Level Classification E-value
Superfamily PGBD-like 2.83e-20
Family MMP N-terminal domain 0.0028
Further Details:      
 

Protein sequence

External link(s) Protein: ENSBTAP00000017168   Gene: ENSBTAG00000012919   Transcript: ENSBTAT00000017168
Sequence length 675
Comment pep:known chromosome:UMD3.1:18:26021950:26043124:1 gene:ENSBTAG00000012919 transcript:ENSBTAT00000017168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRSAPGRPGWAGSLLGGREAATRPQLLPLLLVLLSCLGRGAAAEDAEVNAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKAWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSLEAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNSLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDIDNFQLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPPQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPSDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPDGGAEPGMGGDSEEGEEGGEA
GPGGGGEAGPDEDGGSRVVVQMEEVTRTVNMVMVLVPPVLLLLCILGLTYALVQMQRKGA
PRMLLYCKRSLQEWV
Download sequence
Identical sequences F1MHG1
ENSBTAP00000017168 ENSBTAP00000017168 9913.ENSBTAP00000017168

Jump to [ Top of page · Domain architecture · Domain assignment details ]