SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000017168 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017168
Domain Number 1 Region: 362-559
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-69
Family Hemopexin-like domain 0.00000793
Further Details:      
 
Domain Number 2 Region: 136-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-52
Family Matrix metalloproteases, catalytic domain 0.000000513
Further Details:      
 
Domain Number 3 Region: 53-116
Classification Level Classification E-value
Superfamily PGBD-like 2.83e-20
Family MMP N-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSBTAP00000017168   Gene: ENSBTAG00000012919   Transcript: ENSBTAT00000017168
Sequence length 675
Comment pep:known chromosome:UMD3.1:18:26021950:26043124:1 gene:ENSBTAG00000012919 transcript:ENSBTAT00000017168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRSAPGRPGWAGSLLGGREAATRPQLLPLLLVLLSCLGRGAAAEDAEVNAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKAWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSLEAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNSLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDIDNFQLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPPQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPSDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPDGGAEPGMGGDSEEGEEGGEA
GPGGGGEAGPDEDGGSRVVVQMEEVTRTVNMVMVLVPPVLLLLCILGLTYALVQMQRKGA
PRMLLYCKRSLQEWV
Download sequence
Identical sequences F1MHG1
9913.ENSBTAP00000017168 ENSBTAP00000017168 ENSBTAP00000017168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]