SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017168 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017168
Domain Number 1 Region: 362-559
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-69
Family Hemopexin-like domain 0.00000793
Further Details:      
 
Domain Number 2 Region: 136-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-52
Family Matrix metalloproteases, catalytic domain 0.000000513
Further Details:      
 
Domain Number 3 Region: 53-116
Classification Level Classification E-value
Superfamily PGBD-like 2.83e-20
Family MMP N-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96
Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05

Protein sequence

External link(s) Protein: ENSBTAP00000017168   Gene: ENSBTAG00000012919   Transcript: ENSBTAT00000017168
Sequence length 675
Comment pep:known chromosome:UMD3.1:18:26021950:26043124:1 gene:ENSBTAG00000012919 transcript:ENSBTAT00000017168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRSAPGRPGWAGSLLGGREAATRPQLLPLLLVLLSCLGRGAAAEDAEVNAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKAWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSLEAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNSLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDIDNFQLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPPQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPSDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPDGGAEPGMGGDSEEGEEGGEA
GPGGGGEAGPDEDGGSRVVVQMEEVTRTVNMVMVLVPPVLLLLCILGLTYALVQMQRKGA
PRMLLYCKRSLQEWV
Download sequence
Identical sequences F1MHG1
9913.ENSBTAP00000017168 ENSBTAP00000017168 ENSBTAP00000017168 NP_001178363.1 XP_006072654.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]