SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000019744 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019744
Domain Number 1 Region: 312-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-69
Family Hemopexin-like domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 114-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-55
Family Matrix metalloproteases, catalytic domain 0.0000000236
Further Details:      
 
Domain Number 3 Region: 29-97
Classification Level Classification E-value
Superfamily PGBD-like 6.28e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSBTAP00000019744   Gene: ENSBTAG00000014824   Transcript: ENSBTAT00000019744
Sequence length 582
Comment pep:known chromosome:UMD3.1:10:21806054:21814533:-1 gene:ENSBTAG00000014824 transcript:ENSBTAT00000019744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPACSLLLPVLTLASALASLSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSL
SAAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQH
NEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFF
AEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHEL
GHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTS
RPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFW
RGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFW
MPNGKTYFFRGNKYYRFNEELRIVESEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGN
KYWKFNNQKLKVEPGYPKSALRDWMGCPSSGGQPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences F1N1E3
9913.ENSBTAP00000019744 ENSBTAP00000019744 ENSBTAP00000019744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]