SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000019744 from Bos taurus 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019744
Domain Number 1 Region: 312-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-69
Family Hemopexin-like domain 1.24e-05
Further Details:      
 
Domain Number 2 Region: 114-283
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-55
Family Matrix metalloproteases, catalytic domain 2.36e-08
Further Details:      
 
Domain Number 3 Region: 29-97
Classification Level Classification E-value
Superfamily PGBD-like 6.28e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Protein sequence

External link(s) Protein: ENSBTAP00000019744   Gene: ENSBTAG00000014824   Transcript: ENSBTAT00000019744
Sequence length 582
Comment pep:known chromosome:UMD3.1:10:21806054:21814533:-1 gene:ENSBTAG00000014824 transcript:ENSBTAT00000019744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPACSLLLPVLTLASALASLSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSL
SAAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQH
NEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFF
AEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHEL
GHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTS
RPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFW
RGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFW
MPNGKTYFFRGNKYYRFNEELRIVESEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGN
KYWKFNNQKLKVEPGYPKSALRDWMGCPSSGGQPDEGTEEETEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences F1N1E3
ENSBTAP00000019744 ENSBTAP00000019744 9913.ENSBTAP00000019744

Jump to [ Top of page · Domain architecture · Domain assignment details ]