SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000021014 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021014
Domain Number 1 Region: 272-466
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.23e-71
Family Hemopexin-like domain 7.05e-09
Further Details:      
 
Domain Number 2 Region: 102-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.02e-60
Family Matrix metalloproteases, catalytic domain 1.31e-07
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 9.1e-21
Family MMP N-terminal domain 0.00014
Further Details:      
 

Protein sequence

External link(s) Protein: ENSBTAP00000021014   Gene: ENSBTAG00000048029   Transcript: ENSBTAT00000021014
Sequence length 469
Comment pep:novel chromosome:UMD3.1:15:6124135:6132776:1 gene:ENSBTAG00000048029 transcript:ENSBTAT00000021014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLPLLLLLLWGTGSHGFPAATSETQEQDVETVKKYLENYYNLNSNGKKVERQRNGGLI
TEKLKQMQKFFGLRVTGKPDAETLNVMKQPRCGVPDVAPFVLTPGNPRWENTNLTYRIEN
YTPDLSRADVDQAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGAGIGGDAHFDDDEWWTSNFQDYNLYRVAAHEFGHSLGLAHSTDIGALMYPSY
TFSGDVQLSQDDIDGIQAIYGPSQNPTQPVGPQTPEVCDSKLTFDAITTIRGEVMFFKDR
FYMRTNPLYPEVELNFISVFWPQLPNGLQAAYEVADRDEVRFFKGNKYWAVKGQDVLRGY
PRDIYRSFGFPRTVKSIDAAVSEEDTGKTYFFVANKCWRYDEYKQSMDAGYPKMIAEDFP
GIGNKVDAVFQKGGFFYFFHGRRQYKFDPKTKRILTLLKANSWFNCREN
Download sequence
Identical sequences F1MT97
ENSBTAP00000021014 ENSBTAP00000021014

Jump to [ Top of page · Domain architecture · Domain assignment details ]