SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021014 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021014
Domain Number 1 Region: 272-466
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.23e-71
Family Hemopexin-like domain 0.00000000705
Further Details:      
 
Domain Number 2 Region: 102-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.02e-60
Family Matrix metalloproteases, catalytic domain 0.000000131
Further Details:      
 
Domain Number 3 Region: 22-97
Classification Level Classification E-value
Superfamily PGBD-like 9.1e-21
Family MMP N-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSBTAP00000021014   Gene: ENSBTAG00000048029   Transcript: ENSBTAT00000021014
Sequence length 469
Comment pep:novel chromosome:UMD3.1:15:6124135:6132776:1 gene:ENSBTAG00000048029 transcript:ENSBTAT00000021014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLPLLLLLLWGTGSHGFPAATSETQEQDVETVKKYLENYYNLNSNGKKVERQRNGGLI
TEKLKQMQKFFGLRVTGKPDAETLNVMKQPRCGVPDVAPFVLTPGNPRWENTNLTYRIEN
YTPDLSRADVDQAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGAGIGGDAHFDDDEWWTSNFQDYNLYRVAAHEFGHSLGLAHSTDIGALMYPSY
TFSGDVQLSQDDIDGIQAIYGPSQNPTQPVGPQTPEVCDSKLTFDAITTIRGEVMFFKDR
FYMRTNPLYPEVELNFISVFWPQLPNGLQAAYEVADRDEVRFFKGNKYWAVKGQDVLRGY
PRDIYRSFGFPRTVKSIDAAVSEEDTGKTYFFVANKCWRYDEYKQSMDAGYPKMIAEDFP
GIGNKVDAVFQKGGFFYFFHGRRQYKFDPKTKRILTLLKANSWFNCREN
Download sequence
Identical sequences F1MT97
ENSBTAP00000021014 ENSBTAP00000021014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]