SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSBTAP00000021843 from Bos taurus 73_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021843
Domain Number 1 Region: 335-530
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.88e-55
Family Hemopexin-like domain 1.67e-05
Further Details:      
 
Domain Number 2 Region: 77-296
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.75e-48
Family Matrix metalloproteases, catalytic domain 1.92e-05
Further Details:      
 
Domain Number 3 Region: 37-112
Classification Level Classification E-value
Superfamily PGBD-like 6.75e-19
Family MMP N-terminal domain 0.003
Further Details:      
 

Protein sequence

External link(s) Protein: ENSBTAP00000021843   Gene: ENSBTAG00000016424   Transcript: ENSBTAT00000021843
Sequence length 582
Comment pep:known chromosome:UMD3.1:25:2478689:2488857:1 gene:ENSBTAG00000016424 transcript:ENSBTAT00000021843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRPRARGSPSSPSPPRPRPAPPGLLALLLPLLQPPARAREPSAQDVSLGVDWLTRYGYLP
PPHPAQAQLQSPAKLRDAIKVMQRFAGLPETGVLDPLTVATMHKPRCSLPDVLGAAGLVR
RRRRYALSGSVWKKRTLTWRVNSFPQGSGLSQETVRTLMHHALTTWGAESDLRFQEVGSQ
GPTEPDILIDFARAYHQDSYPFDGQGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGE
GTDLFAVAVHEFGHALGLGHSSAPDSIMRPFYQGPVGNPAEYRLSQDDREGLQQLYGTAG
GRAPQTPYDKPTRKPLAPPPPPPALPPDSTPQPLPDRCDGNFDAIANIRGETFFFKGPWF
WRLQPSGQLVSPRPARLHRFWEGLPTQVKVIQAAYARHPDGRILLFSGPQFWSFQDRLLE
GAARPLTELGLPPGTEVDAVFSWPLNGKTYLIRGRQYWRYDEAAARPDPGYPRDLSLWEG
APSAPDDVTVSNTGDTYFFKGLHYWRFPKGSIKAEPDSPQPMGPKFLDCPAPTVGPRAPR
PPRATLKAGDCDCQCGISRAAGRPSVLLLPLLSLLVGGLASP
Download sequence
Identical sequences F1N1F5
ENSBTAP00000021843 ENSBTAP00000021843

Jump to [ Top of page · Domain architecture · Domain assignment details ]