SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338529930|ref|YP_004663264.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338529930|ref|YP_004663264.1|
Domain Number 1 Region: 387-584
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.35e-26
Family Prokaryotic proteases 0.0026
Further Details:      
 
Domain Number 2 Region: 1081-1186
Classification Level Classification E-value
Superfamily HCP-like 0.000000000000196
Family HCP-like 0.0018
Further Details:      
 
Domain Number 3 Region: 614-801
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000251
Family Prokaryotic proteases 0.011
Further Details:      
 
Weak hits

Sequence:  gi|338529930|ref|YP_004663264.1|
Domain Number - Region: 969-1030
Classification Level Classification E-value
Superfamily HCP-like 0.00746
Family HCP-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338529930|ref|YP_004663264.1|
Sequence length 1210
Comment protease Do [Myxococcus fulvus HW-1]
Sequence
MRTAPEASAKVLSSRRRTEEEEVLGDFSIDVDLEPEAPAPPRRVRPAPAPRAARAPGLAG
RLRDRWSAWVPEESTSGARIAAVFLLVNAALTVAGHFLYPHSRVVDVSGWVSSAVDVALA
VGLLVGARRAHSLMLVRLFLGLLLMLGTAAFAAPSVVVLQAGGMLGLLLLLVGAPGARRQ
TAGALVSGATCLILVVLLSSRFTQTSPLDGWVLRLDGALEPGAVTDVQGLDADYTLTFPA
TGWRQARPEHVAKMSPGFDRVWLLPARGAVVSTRVLHVPGAGGVDLDEAAEKMLESRPDA
EEGAEDTEVVATEPIDGTFDAARRYHLRLRKDGQPMEAHAAVVVQGDYAFFIDAVAPRHR
FASLDQELADIVASFAFQVVTPRLEAGVLDKVRQAAVQVLSGEASGSGFVIHSENERTLV
ITNDHVIREKGEVPRFVKVVMMTRSGRREVFDAIVAASDEEQDLALLSLTEAFGTWPALD
FRHTAKLPPRSPLFVVGFPFGGSLAVRGTYPEVSLNAGWMASRTPAPLLEKGLRVVDVGI
NPGNSGGAVVDASGRVLGVAVAHVQGSATSVVISTETVSDWLRRAKDFTLTFDDRELDVA
EASQHALHAEGEARARAATVLVRSAQGSTAGVIVGRKGEHHLLVIASLDALGEAWRPGTA
LPEMTVRFRPAQPESVDRKAEVLRASAEAGMVLLSVVGRPDDAEPLEPASASKHDSGTPV
RVLGYRLGEDGKLLRKNPSAQAAAGAVASVQRDSNQQVRFLHVDVGVNYGQTTGPVLDAQ
GALVGLAVARVKNTNVSLVLPGENLVGLLRGGIRSGGWKLFRDRDGRCALSVLAVLDNPL
GVSQTVQVRMSREPVYGEPSGPAGVKPLGEALIAADAGHRSQLELTAEVDCAAVAPSVQL
GLVDSQGSRYTAPGRGEHRSGGMLMGLVAGTSGAGDEADDMVEFFLSPVPAPGAWGQECA
EGDAVLCRQQCDVAQSRPCLRLGRLHLEASRHAEALAAFTRSCSLGNLNGCIELGLASQS
MGSRRGSIAWPDESEERLRKVCQASSQHPDSRRACWALRPESYDTALSSAVRLCASSRVQ
CTELGHLYLAGSWNPQRFGTSAAKAFSMGCETGDAQACLSLARLQLEGVGVPRNIRVAMN
TFEKHCQQGRYLGCEDLARMHATGLGVPKNLAESRRLMREICRTGVSRSPHCEFVRHQAR
NERLGTARRE
Download sequence
Identical sequences F8CB81
gi|338529930|ref|YP_004663264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]