SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for gi|302337704|ref|YP_003802910.1| from Spirochaeta smaragdinae DSM 11293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302337704|ref|YP_003802910.1|
Domain Number 1 Region: 908-1086
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-37
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 1112-1227
Classification Level Classification E-value
Superfamily CheY-like 1.34e-35
Family CheY-related 0.0025
Further Details:      
 
Domain Number 3 Region: 125-336
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.1e-19
Family SGL-like 0.023
Further Details:      
 
Domain Number 4 Region: 840-920
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.61e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 
Domain Number 5 Region: 320-542
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.82e-14
Family SGL-like 0.061
Further Details:      
 
Domain Number 6 Region: 11-122
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.47e-06
Family SGL-like 0.042
Further Details:      
 
Domain Number 7 Region: 507-664
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 2.09e-05
Family SGL-like 0.034
Further Details:      
 

Protein sequence

External link(s) gi|302337704|ref|YP_003802910.1|
Sequence length 1230
Comment histidine kinase [Spirochaeta smaragdinae DSM 11293]
Sequence
MLFLYSGFLLHGLDLPRQIRFDPLTTREGLSSSSVSGILQDKDGIIWIATQAGLNRYDGY
SFTYYENDPFNRNSLSHNLIQTTYLDEAGIIWLGTYGGLNRFDPKSGDFDAYIHDARRPD
SLSNNVVVAITRDRDGNLWVGTLDGLNRLDTKTGSFTRYYPDPDDPSSVPDKVIRTLLVD
DFGQLWIGSYGGLSRYLPETDAFEQIPIDTAGDGNGLLSPYVMSLCRNNEDSSSIFVGTW
DGGISSLDVANGRIHHYPIPSEMLYQIMNDSKGRIWAATWGDGLIVLNPENGETIQYRDK
EYAVEQKGLSHNVVYSLFEDDSGIIWIGTNGGGVNKYVEWSNRYRFIVNESGNPNSLSEG
KVTSILEDEDGSLWIGVYSGGLNHYDPATGMVRRYSFDKEDTHSLSDNIVNVLFRDREDH
LWIGTNDGLNRYLPDSDTFERVYADGSDRTPPESIIYTMAEDRKGNLWIGTNSSGAAVKK
AGEERFINYAYDAADPGSLSDNLVRTVFEDSYGILWIGTNNGLNRYHANTGTFSRYYHDP
DQPQTLSSDNIRVILEDSSGTLWIATAGGGLNRYNRKDDSFSAVSRKDGLLSNHILAMVE
RNPGELWLSTNRGLCIYNVEQGTFRTIDAENGLLTSELTTGLTLGRSENLYVGGVRGVTI
IDREDTAGDPYIPPLVVTHFEVLGEERKLLKSGEKSYEELLLSPSDKLFSLQVAALDYSS
PERNQYAFMLEGFDDSLIYSGTRNYVRYTNIDPGRYTLRIIGAGSRGNWNETGLTIPIRV
LPPWWLSHPAFAAYLLVSLLFVLLLVNHYRIRRQRLEERYAEQERINRELDQKVKERTAE
IEKARKVAEEATKAKSLFLANMSHEIRTPLTGMLGMFSLLAKTKLNQNQRSFLDYSRTAA
ENLNQLVNDLLDVESIESGTLPLHETRFDPEKALAYVYHLFEERAKAQGLDFFLDIEASD
PSLEVLGDRNRFIQIVTNLVSNALKYTESGSISLKLTIAPAELTQAEAQRRRSYTVTVSD
TGIGIPKDKTGSIFESFTQLDTGYAKSSKGVGLGLAIVKQLVDAMDGTISVESSPGGTSF
TVSLSFPVAPPQEEAEETERTTASDNNSGIGKILVCEDEGINRFYLGTLLQNKGFAVDVA
ANGREAVRLAESNDYSLILMDLGMPEIDGLEATRMIRAQGITVPIIALTAHSYKEDIDKC
REAGMDDFLAKPILEPLLFKKIRTWIGDKT
Download sequence
Identical sequences E1R2N4
gi|302337704|ref|YP_003802910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]