SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302337704|ref|YP_003802910.1| from Spirochaeta smaragdinae DSM 11293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302337704|ref|YP_003802910.1|
Domain Number 1 Region: 908-1086
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-37
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 1112-1227
Classification Level Classification E-value
Superfamily CheY-like 1.34e-35
Family CheY-related 0.0025
Further Details:      
 
Domain Number 3 Region: 125-336
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.1e-19
Family SGL-like 0.023
Further Details:      
 
Domain Number 4 Region: 840-920
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.61e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 
Domain Number 5 Region: 320-542
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000000000582
Family SGL-like 0.061
Further Details:      
 
Domain Number 6 Region: 11-122
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000347
Family SGL-like 0.042
Further Details:      
 
Domain Number 7 Region: 507-664
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000209
Family SGL-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
chromosomal part 1.471 19.38
nuclear chromosome 1.727 19.38
condensed chromosome 2.217 19.38
lipid particle 1.395 15.85
DNA repair complex 2.07 12.63
cell surface 1.26 6.69
mitochondrial matrix 1.568 6.07
external encapsulating structure 1.708 5.91
cell wall 1.769 5.91
oxidoreductase complex 1.774 5.12

Protein sequence

External link(s) gi|302337704|ref|YP_003802910.1|
Sequence length 1230
Comment histidine kinase [Spirochaeta smaragdinae DSM 11293]
Sequence
MLFLYSGFLLHGLDLPRQIRFDPLTTREGLSSSSVSGILQDKDGIIWIATQAGLNRYDGY
SFTYYENDPFNRNSLSHNLIQTTYLDEAGIIWLGTYGGLNRFDPKSGDFDAYIHDARRPD
SLSNNVVVAITRDRDGNLWVGTLDGLNRLDTKTGSFTRYYPDPDDPSSVPDKVIRTLLVD
DFGQLWIGSYGGLSRYLPETDAFEQIPIDTAGDGNGLLSPYVMSLCRNNEDSSSIFVGTW
DGGISSLDVANGRIHHYPIPSEMLYQIMNDSKGRIWAATWGDGLIVLNPENGETIQYRDK
EYAVEQKGLSHNVVYSLFEDDSGIIWIGTNGGGVNKYVEWSNRYRFIVNESGNPNSLSEG
KVTSILEDEDGSLWIGVYSGGLNHYDPATGMVRRYSFDKEDTHSLSDNIVNVLFRDREDH
LWIGTNDGLNRYLPDSDTFERVYADGSDRTPPESIIYTMAEDRKGNLWIGTNSSGAAVKK
AGEERFINYAYDAADPGSLSDNLVRTVFEDSYGILWIGTNNGLNRYHANTGTFSRYYHDP
DQPQTLSSDNIRVILEDSSGTLWIATAGGGLNRYNRKDDSFSAVSRKDGLLSNHILAMVE
RNPGELWLSTNRGLCIYNVEQGTFRTIDAENGLLTSELTTGLTLGRSENLYVGGVRGVTI
IDREDTAGDPYIPPLVVTHFEVLGEERKLLKSGEKSYEELLLSPSDKLFSLQVAALDYSS
PERNQYAFMLEGFDDSLIYSGTRNYVRYTNIDPGRYTLRIIGAGSRGNWNETGLTIPIRV
LPPWWLSHPAFAAYLLVSLLFVLLLVNHYRIRRQRLEERYAEQERINRELDQKVKERTAE
IEKARKVAEEATKAKSLFLANMSHEIRTPLTGMLGMFSLLAKTKLNQNQRSFLDYSRTAA
ENLNQLVNDLLDVESIESGTLPLHETRFDPEKALAYVYHLFEERAKAQGLDFFLDIEASD
PSLEVLGDRNRFIQIVTNLVSNALKYTESGSISLKLTIAPAELTQAEAQRRRSYTVTVSD
TGIGIPKDKTGSIFESFTQLDTGYAKSSKGVGLGLAIVKQLVDAMDGTISVESSPGGTSF
TVSLSFPVAPPQEEAEETERTTASDNNSGIGKILVCEDEGINRFYLGTLLQNKGFAVDVA
ANGREAVRLAESNDYSLILMDLGMPEIDGLEATRMIRAQGITVPIIALTAHSYKEDIDKC
REAGMDDFLAKPILEPLLFKKIRTWIGDKT
Download sequence
Identical sequences E1R2N4
gi|302337704|ref|YP_003802910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]