SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297560454|ref|YP_003679428.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297560454|ref|YP_003679428.1|
Domain Number 1 Region: 204-375
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.79e-31
Family Prokaryotic proteases 0.0000398
Further Details:      
 
Weak hits

Sequence:  gi|297560454|ref|YP_003679428.1|
Domain Number - Region: 143-188
Classification Level Classification E-value
Superfamily Alpha-lytic protease prodomain 0.00144
Family Alpha-lytic protease prodomain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297560454|ref|YP_003679428.1|
Sequence length 384
Comment peptidase S1 and S6 chymotrypsin/Hap [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MRPSSIISAVGTGALAFGMALAMAPGALAAPAPVPQTPVADDSAASMTEALKRDLDLTSA
EAEELLSAQEAAIETDAEATEAAGEAYGGSLFDTETLELTVLVTDASAVEAVEATGAQAT
VVSHGTEGLTEVVEDLNGAEVPESVLGWYPDVESDTVVVEVLEGSDADVAALLADAGVDS
SSVRVEETEEAPQVYADIIGGLAYYMGGRCSVGFAATNSAGQPGFVTAGHCGTVGTGVTI
GNGTGTFQNSVFPGNDAAFVRGTSNFTLTNLVSRYNSGGYQSVTGTSQAPAGSAVCRSGS
TTGWHCGTIQARNQTVRYPQGTVYSLTRTNVCAEPGDSGGSFISGSQAQGVTSGGSGNCS
VGGTTYYQEVTPMINSWGVRIRTS
Download sequence
Identical sequences D7B3J4
WP_013152529.1.70090 WP_013152529.1.87825 gi|297560454|ref|YP_003679428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]