SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gnuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gnuA
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-74
Family GABARAP-like 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gnuA   PDB: 1gnu   SUPERFAMILY: 1gnuA
Sequence length 117
Comment (A:)
Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Download sequence
Identical sequences A0A091CLV1 A0A0D9RHK5 A0A1S3GV44 A0A1U7TMR4 A0A212D848 A0A250Y992 A0A2I3GQ66 A0A2K5DHD0 A0A2K5KPF0 A0A2K5QL46 A0A2K5W9B8 A0A2K5ZL23 A0A2K6E5T4 A0A2K6G2H3 A0A2K6N840 A0A2K6TIE1 D7RA28 F1Q2L2 F6U6S1 F7ANW4 G1MDM5 G1P2V9 G3RD36 G3SMA6 G3W239 G5B5A5 H0WPT0 H2NSH8 H2QC26 I3MTA2 L5JWS8 L8IX54 M3X7G0 O95166 P60517 Q5PPQ1 Q6IAW1 Q8MK68 Q9DCD6 Q9GJW7 S7NE50 W5PMY4
ENSBTAP00000019814 ENSAMEP00000017453 ENSDORP00000004890 ENSMUSP00000018711 ENSSHAP00000009494 ENSOGAP00000003919 ENSCAFP00000023725 NP_001029220.1.59421 NP_001029220.1.76553 NP_001075611.1.1745 NP_001177217.1.46622 NP_001247958.1.72884 NP_009209.1.87134 NP_009209.1.92137 NP_062723.1.92730 NP_742033.1.100692 NP_742033.1.4139 XP_001370360.2.35504 XP_002748033.2.60252 XP_002826992.1.23681 XP_002924525.1.58354 XP_003282190.1.23891 XP_003315392.1.37143 XP_003416932.1.64505 XP_003497241.1.69978 XP_003791227.1.62490 XP_003810165.1.60992 XP_003929198.1.74449 XP_003996209.1.62641 XP_004012690.1.66739 XP_004058504.1.27298 XP_004266982.1.21590 XP_004326139.1.83887 XP_004376109.1.4749 XP_004398594.1.74151 XP_004433222.1.5094 XP_004594877.1.84141 XP_004604949.1.94378 XP_004638441.1.9945 XP_004669311.1.11716 XP_004684738.1.23501 XP_004712939.1.18182 XP_004857437.1.39548 XP_005332825.1.77405 XP_005349783.1.66349 XP_005399595.1.28644 XP_005582774.1.63531 XP_005693542.1.57651 XP_005878785.1.60319 XP_005890016.1.15283 XP_005967959.1.78601 XP_006060215.1.26621 XP_006105538.1.53796 XP_006151889.1.99106 XP_006175846.1.101512 XP_006218869.1.17985 XP_006738983.1.47382 XP_006863409.1.41390 XP_006899162.1.29581 XP_006922360.1.64745 XP_006973467.1.50099 XP_007100743.1.24612 XP_007166523.1.59432 XP_007457812.1.90284 XP_007625171.1.28591 XP_007950487.1.48129 XP_008008292.1.81039 XP_008059110.1.4292 XP_008151771.1.99482 XP_008528625.1.77740 XP_008572110.1.73410 XP_008590387.1.73410 XP_008686170.1.72690 XP_010370554.1.97406 XP_010375633.1.97406 XP_010387021.1.97406 XP_010613116.1.5607 XP_010845645.1.44457 XP_010964188.1.22495 XP_011357963.1.92234 XP_011725364.1.29376 XP_011850006.1.47321 XP_011908780.1.92194 XP_011978063.1.54773 XP_012312870.1.9421 XP_012511112.1.63892 XP_012632345.1.48125 XP_012892671.1.60039 XP_014716986.1.49734 XP_014924953.1.86478 XP_014967351.1.72884 XP_015359880.1.40921 XP_015997598.1.101085 XP_016077907.1.3490 XP_017387198.1.71028 XP_017522494.1.32401 XP_017752047.1.44346 XP_019269189.1.44245 XP_019520387.1.44202 XP_019600691.1.88060 XP_019782343.1.83887 XP_019836743.1.53367 XP_020007081.1.5219 XP_020768722.1.74333 XP_020822093.1.61212 XP_021068019.1.100879 XP_021503892.1.76796 XP_021550516.1.83697 XP_536616.2.84170 ENSCJAP00000030659 ENSCAFP00000023725 ENSCJAP00000030659 ENSOCUP00000006049 ENSPCAP00000014449 ENSSTOP00000015347 ENSOGAP00000003919 ENSOCUP00000006049 ENSRNOP00000023724 ENSPPYP00000008889 ENSMUSP00000018711 ENSDORP00000004890 ENSPTRP00000014784 ENSMMUP00000013823 ENSMMUP00000030224 ENSBTAP00000019814 ENSNLEP00000009818 ENSRNOP00000023724 gi|6005764|ref|NP_009209.1| ENSP00000306866 ENSSSCP00000019002 ENSSSCP00000020071 HGL_H00000306866 ENSPPYP00000008889 gi|56268988|gb|AAH87560| gi|58332086|ref|NP_001011192| ENSOARP00000011809 ENSMMUP00000013823 ENSMMUP00000030224 001146009|e3wimA1|221.1.1.3|A:1-117 cath|current|1gnuA00/1-117 cath|current|3wimA00/1-117 d1gnua_ d1kota1 d3dowa1 1gnuA ENSP00000306866 ENSMUSP00000018711 ENSPTRP00000014784 ENSNLEP00000009818 ENSMLUP00000004213 ENSLAFP00000000628 ENSAMEP00000017453 ENSSTOP00000015347 ENSSSCP00000019002 ENSSSCP00000020071 1gnu_A 1klv_A 1km7_A 3wim_A 5yir_A 5yir_B 5yir_D ENSLAFP00000000628 ENSMLUP00000004213 ENSSHAP00000009494 10090.ENSMUSP00000018711 10116.ENSRNOP00000023724 9544.ENSMMUP00000013823 9544.ENSMMUP00000030224 9598.ENSPTRP00000014784 9600.ENSPPYP00000008889 9606.ENSP00000306866 9823.ENSSSCP00000019002 9913.ENSBTAP00000019814 9986.ENSOCUP00000006049 ENSP00000306866 ENSPCAP00000014449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]