SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1goiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1goiA
Domain Number 1 Region: 4-291,379-436
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.13e-88
Family Type II chitinase 0.00000000000636
Further Details:      
 
Domain Number 2 Region: 292-379
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.24e-24
Family Chitinase insertion domain 0.00000162
Further Details:      
 
Domain Number 3 Region: 449-497
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000278
Family Carbohydrate binding domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1goiA   PDB: 1goi
Sequence length 499
Comment (A:)
Sequence
mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
akfaqscvrimkdygfdgvnidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
yitsapgsdsawlkvgrva
Download sequence
Identical sequences 1goiA 1goi_A 1goi_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]