SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gxmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gxmA
Domain Number 1 Region: 24-326
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 7.32e-94
Family Family 10 polysaccharide lyase 0.0000000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gxmA   PDB: 1gxm   SUPERFAMILY: 1gxmA
Sequence length 332
Comment (A:)
Sequence
glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
itqmslerrtgyswggnygtsiinfaqkvgyl
Download sequence
Identical sequences 1gxm_A 1gxm_B 1gxn_A 1gxmA cath|current|1gxmA00/326-649 cath|current|1gxmB00/318-649 cath|current|1gxnA00/327-649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]